SDS-Page
Mesothelin Recombinant Protein | Msln recombinant protein
Recombinant Mouse Mesothelin
Gene Names
Msln; MPF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mesothelin; Recombinant Mouse Mesothelin; Pre-pro-megakaryocyte-potentiating factor; Msln recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
298-600aa; Partial
Sequence
DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Sequence Length
600
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for Msln recombinant protein
membrane-anchored forms may play a role in cellular adhesion.
References
Mouse megakaryocyte potentiating factor cDNA.Kojima T., Taniguchi Y., Hattori K., Oh-eda M.
Mesothelin is not required for normal mouse development or reproduction.Bera T.K., Pastan I.Mol. Cell. Biol. 20:2902-2906(2000)
Stromelysin-1 and mesothelin are differentially regulated by Wnt-5a and Wnt-1 in C57mg mouse mammary epithelial cells.Prieve M.G., Moon R.T.BMC Dev. Biol. 3:2-2(2003)
Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.Rump A., Morikawa Y., Tanaka M., Minami S., Umesaki N., Takeuchi M., Miyajima A.J. Biol. Chem. 279:9190-9198(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.1 kDa
NCBI Official Full Name
mesothelin
NCBI Official Synonym Full Names
mesothelin
NCBI Official Symbol
Msln
NCBI Official Synonym Symbols
MPF
NCBI Protein Information
mesothelin
UniProt Protein Name
Mesothelin
Protein Family
UniProt Gene Name
Msln
UniProt Synonym Gene Names
Mes; Mpf; MPF
UniProt Entry Name
MSLN_MOUSE
Uniprot Description
MSLN: Membrane-anchored forms may play a role in cellular adhesion. Antibodies against MSLN are detected in patients with mesothelioma and ovarian cancer. Belongs to the mesothelin family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell adhesion; Membrane protein, GPI anchor
Cellular Component: cell surface; extracellular region; extracellular space; Golgi apparatus; membrane; plasma membrane
Molecular Function: protein binding
Biological Process: cell adhesion; cell-matrix adhesion
Research Articles on Msln
Similar Products
Product Notes
The Msln msln (Catalog #AAA1382431) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 298-600aa; Partial. The amino acid sequence is listed below: DAEQKACPPG KEPYKVDEDL IFYQNWELEA CVDGTMLARQ MDLVNEIPFT YEQLSIFKHK LDKTYPQGYP ESLIQQLGHF FRYVSPEDIH QWNVTSPDTV KTLLKVSKGQ KMNAQAIALV ACYLRGGGQL DEDMVKALGD IPLSYLCDFS PQDLHSVPSS VMWLVGPQDL DKCSQRHLGL LYQKACSAFQ NVSGLEYFEK IKTFLGGASV KDLRALSQHN VSMDIATFKR LQVDSLVGLS VAEVQKLLGP NIVDLKTEED KSPVRDWLFR QHQKDLDRLG LGLQGGIPNG YLVLDFNVRE AFS. It is sometimes possible for the material contained within the vial of "Mesothelin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
