Mechanosensitive ion channel protein 2 (MSL2) Recombinant Protein | MSL2 recombinant protein
Recombinant Arabidopsis thaliana Mechanosensitive ion channel protein 2, chloroplastic (MSL2)
Gene Names
MSL2; F12B17.160; F12B17_160; MSCS-like 2; MSL2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mechanosensitive ion channel protein 2 (MSL2); Recombinant Arabidopsis thaliana Mechanosensitive ion channel protein 2; chloroplastic (MSL2); MSL2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
76-673aa; full length protein
Sequence
CHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPAVALLVFSLWGLVPFARQGR NILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVVLPTEASKIVKDRLLNF VRSLSTVLAFAYCLSSLIQQTQKLFSETSNPSDTRNMGFQFAGKALYSAVWVAAVSLFME LLGFSTQKWLTAGGLGTVLITLAGREILTNFLSSVMIHATRPFVLNEWIQTKIEGYEVSG TVEHVGWWSPTIIRGEDREAIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINN IVADMRKVLAKNPMVEQQRLHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAIL LDLLRVISHHRARLATPIRTIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING EDKSKSQNRAAKPTAEQENKGSNPKSKETSSPDLKANVKVGESPVSDTNKVPEETVAKPV IKAVSKPPTPKDTETSGTEKPKAKRSGGTIKSTKTDETDSSTSSASRSTLEENIVLGVAL EGSKRTLPIEEEIHSPPMETDAKELTGARRSGGNGPLVADKEQKDSQSQPNSGASTEP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MSL2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
71,322 Da
NCBI Official Full Name
mechanosensitive ion channel protein 2
NCBI Official Symbol
MSL2
NCBI Official Synonym Symbols
F12B17.160; F12B17_160; MSCS-like 2; MSL2
NCBI Protein Information
mechanosensitive ion channel protein 2
UniProt Protein Name
Mechanosensitive ion channel protein 2, chloroplastic
Protein Family
UniProt Gene Name
MSL2
UniProt Entry Name
MSL2_ARATH
Uniprot Description
Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer (). Controls plastid size, shape, and perhaps division during normal plant development by altering ion flux in response to changes in membrane tension. Acts as a component of the chloroplast division machinery.
Research Articles on MSL2
Similar Products
Product Notes
The MSL2 msl2 (Catalog #AAA7021325) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 76-673aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MSL2 msl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CHSFSASGKA IEPAVKAVTV VLTKSHGLMQ QFPFVYKLVP AVALLVFSLW GLVPFARQGR NILLNKNDNG WKKSGTYHVM TSYVQPLLLW LGALFICRAL DPVVLPTEAS KIVKDRLLNF VRSLSTVLAF AYCLSSLIQQ TQKLFSETSN PSDTRNMGFQ FAGKALYSAV WVAAVSLFME LLGFSTQKWL TAGGLGTVLI TLAGREILTN FLSSVMIHAT RPFVLNEWIQ TKIEGYEVSG TVEHVGWWSP TIIRGEDREA IHIPNHKFTV NVVRNLTQKT HWRIKTHLAI SHLDVNKINN IVADMRKVLA KNPMVEQQRL HRRVFLENVI PENQALSILI SCFVKTSHHE EYLGVKEAIL LDLLRVISHH RARLATPIRT IRKMYTETDV ENTPFGESMY GGVTSRRPLM LIEPAYKING EDKSKSQNRA AKPTAEQENK GSNPKSKETS SPDLKANVKV GESPVSDTNK VPEETVAKPV IKAVSKPPTP KDTETSGTEK PKAKRSGGTI KSTKTDETDS STSSASRSTL EENIVLGVAL EGSKRTLPIE EEIHSPPMET DAKELTGARR SGGNGPLVAD KEQKDSQSQP NSGASTEP. It is sometimes possible for the material contained within the vial of "Mechanosensitive ion channel protein 2 (MSL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
