Mechanosensitive ion channel protein 10 (MSL10) Recombinant Protein | MSL10 recombinant protein
Recombinant Arabidopsis thaliana Mechanosensitive ion channel protein 10 (MSL10)
Gene Names
MSL10; ATMSL10; F14F18.230; F14F18_230; mechanosensitive channel of small conductance-like 10; MSL10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mechanosensitive ion channel protein 10 (MSL10); Recombinant Arabidopsis thaliana Mechanosensitive ion channel protein 10 (MSL10); MSL10 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-734aa; full length protein
Sequence
MAEQKSSNGGGGGGDVVINVPVEEASRRSKEMASPESEKGVPFSKSPSPEISKLVGSPNK PPRAPNQNNVGLTQRKSFARSVYSKPKSRFVDPSCPVDTSILEEEVREQLGAGFSFSRAS PNNKSNRSVGSPAPVTPSKVVVEKDEDEEIYKKVKLNREMRSKISTLALIESAFFVVILS ALVASLTINVLKHHTFWGLEVWKWCVLVMVIFSGMLVTNWFMRLIVFLIETNFLLRRKVL YFVHGLKKSVQVFIWLCLILVAWILLFNHDVKRSPAATKVLKCITRTLISILTGAFFWLV KTLLLKILAANFNVNNFFDRIQDSVFHQYVLQTLSGLPLMEEAERVGREPSTGHLSFATV VKKGTVKEKKVIDMGKVHKMKREKVSAWTMRVLMEAVRTSGLSTISDTLDETAYGEGKEQ ADREITSEMEALAAAYHVFRNVAQPFFNYIEEEDLLRFMIKEEVDLVFPLFDGAAETGRI TRKAFTEWVVKVYTSRRALAHSLNDTKTAVKQLNKLVTAILMVVTVVIWLLLLEVATTKV LLFFSTQLVALAFIIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVF LKLNNEKVYYPNAVLATKPISNYFRSPNMGETVEFSISFSTPVSKIAHLKERIAEYLEQN PQHWAPVHSVVVKEIENMNKLKMALYSDHTITFQENRERNLRRTELSLAIKRMLEDLHID YTLLPQDINLTKKN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MSL10 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,032 Da
NCBI Official Full Name
mechanosensitive channel of small conductance-like 10
NCBI Official Symbol
MSL10
NCBI Official Synonym Symbols
ATMSL10; F14F18.230; F14F18_230; mechanosensitive channel of small conductance-like 10; MSL10
NCBI Protein Information
mechanosensitive channel of small conductance-like 10
UniProt Protein Name
Mechanosensitive ion channel protein 10
Protein Family
UniProt Gene Name
MSL10
UniProt Synonym Gene Names
AtMSL10
UniProt Entry Name
MSL10_ARATH
Uniprot Description
Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer.
Research Articles on MSL10
Similar Products
Product Notes
The MSL10 msl10 (Catalog #AAA7021324) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-734aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MSL10 msl10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEQKSSNGG GGGGDVVINV PVEEASRRSK EMASPESEKG VPFSKSPSPE ISKLVGSPNK PPRAPNQNNV GLTQRKSFAR SVYSKPKSRF VDPSCPVDTS ILEEEVREQL GAGFSFSRAS PNNKSNRSVG SPAPVTPSKV VVEKDEDEEI YKKVKLNREM RSKISTLALI ESAFFVVILS ALVASLTINV LKHHTFWGLE VWKWCVLVMV IFSGMLVTNW FMRLIVFLIE TNFLLRRKVL YFVHGLKKSV QVFIWLCLIL VAWILLFNHD VKRSPAATKV LKCITRTLIS ILTGAFFWLV KTLLLKILAA NFNVNNFFDR IQDSVFHQYV LQTLSGLPLM EEAERVGREP STGHLSFATV VKKGTVKEKK VIDMGKVHKM KREKVSAWTM RVLMEAVRTS GLSTISDTLD ETAYGEGKEQ ADREITSEME ALAAAYHVFR NVAQPFFNYI EEEDLLRFMI KEEVDLVFPL FDGAAETGRI TRKAFTEWVV KVYTSRRALA HSLNDTKTAV KQLNKLVTAI LMVVTVVIWL LLLEVATTKV LLFFSTQLVA LAFIIGSTCK NLFESIVFVF VMHPYDVGDR CVVDGVAMLV EEMNLLTTVF LKLNNEKVYY PNAVLATKPI SNYFRSPNMG ETVEFSISFS TPVSKIAHLK ERIAEYLEQN PQHWAPVHSV VVKEIENMNK LKMALYSDHT ITFQENRERN LRRTELSLAI KRMLEDLHID YTLLPQDINL TKKN. It is sometimes possible for the material contained within the vial of "Mechanosensitive ion channel protein 10 (MSL10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
