DNA mismatch repair protein Msh6 (Msh6) Recombinant Protein | Msh6 recombinant protein

Recombinant Mouse DNA mismatch repair protein Msh6 (Msh6) , partial

Cat. Num. AAA959848

• Gene Names: Msh6; GTBP; Gtmbp; AU044881; AW550279
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA mismatch repair protein Msh6 (Msh6); Recombinant Mouse DNA mismatch repair protein Msh6 (Msh6); partial; Msh6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-396. Partial.
• Sequence: MSRQSTLYSFFPKSPALGDTKKAAAEASRQGAAASGASASRGGDAAWSEAEPGSRSAAVSASSPEAKDLNGGLRRASSSAQAVPPSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIRKKGKSVRVHVQFFDDSPTRGWVSKRMLKPYTGSKSKEAQKGGHFYSSKSEILRAMQRADEALSKDTAERLQLAVCDEPSEPEEEEETEVHEAYLSDKSEEDNYNESEEEAQPSVQGPRRSSRQVKKRRVISDSESDIGGSDVEFKPDTKQEGSSDDASSGVGDSDSEDLGTFGKGAPKRKRAMVAQGGLRRKSLKKETGSAKRATPILSETKSTLSAFSAPQNSESQTHVSGGGNDSSGPTVWYHETLEWLKPEKRRDEHRRRPDHPEFNPTTLY
• Sequence Length: 396

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Msh6 recombinant protein

This gene encodes a protein similar to the MutS protein. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides, prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein of this gene combines with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene have been identified in individuals with hereditary nonpolyposis colon cancer (HNPCC) and endometrial cancer.

NCBI and Uniprot Product Information

• NCBI GI #: 6754744
• NCBI GeneID: 17688
• NCBI Accession #: NP_034960.1
• NCBI GenBank Nucleotide #: NM_010830.2
• UniProt Accession #: P54276; O54710; Q6GTK8
• Molecular Weight: 151,084 Da
• NCBI Official Full Name: DNA mismatch repair protein Msh6
• NCBI Official Synonym Full Names: mutS homolog 6
• NCBI Official Symbol: Msh6
• NCBI Official Synonym Symbols: GTBP; Gtmbp; AU044881; AW550279
• NCBI Protein Information: DNA mismatch repair protein Msh6
• UniProt Protein Name: DNA mismatch repair protein Msh6
• Protein Family: DNA mismatch repair protein
• UniProt Gene Name: Msh6
• UniProt Synonym Gene Names: p160

Uniprot Description

Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch: mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. Recruited on chromatin in G1 and early S phase via its PWWP domain that specifically binds trimethylated 'Lys-36' of histone H3 (H3K36me3): early recruitment to chromatin to be replicated allowing a quick identification of mismatch repair to initiate the DNA mismatch repair reaction ().