Lipid A export ATP-binding/permease protein MsbA 1 (msbA1) Recombinant Protein | msbA1 recombinant protein
Recombinant Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1 (msbA1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid A export ATP-binding/permease protein MsbA 1 (msbA1); Recombinant Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1 (msbA1); msbA1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-602aa; full length protein
Sequence
MASSPKTNALSSSDSANATTWQNFKRLVSYAKPYKLGFVAAIIGMLGYAAIDVYFLSQLK PLVDEGLSGANANFMKWAPLFIIVAFTVRGIAHFIANYCLAWVGNNVVADLRQKLFEHIM SMPVAFHDQTSTGSLISKITFDTEQVLNSVSKSILTIVQQSAFIIGLLGLMFYYSWQLSL IFLLITPIIAVIVSVVSKRFRKVSKNIQGAMGEVTTAAEQTFNGHKVVLTFGGQQREFSR FAKINKHNRQQRMKMRATKSASVPIIQVIASFALAFVFYAITSDSLRDSISPGTFVSIIT YMTMLLRPLKMLTNVNSEFQQGMAACTSIFSILDHEKEKDNGDKQLERASGTLSFKHVDF SYKNTNTMTTSDKEQDTKLALNDITFDLAPGETLALVGRSGSGKSTASSLLLRFYDATRG EILIDDTNIEQFQLKDLRKQFSYVSQQVVLFNDTLANNIAYGKPEATEAEIIEAAKSAHV MEFAEHMEQGLETNIGENGALLSGGQRQRVAIARALLCDTPFLILDEATSALDTESERHI QDALQTLQQNRTSIVIAHRLSTIENADKIIVMEQGKIVEQGNHQSLLAKQGAYAQLHSFQ FE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for msbA1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
66,639 Da
NCBI Official Full Name
Lipid A export ATP-binding/permease protein MsbA 1
UniProt Protein Name
Lipid A export ATP-binding/permease protein MsbA 1
Protein Family
UniProt Gene Name
msbA1
UniProt Entry Name
MSBA1_COLP3
Uniprot Description
Involved in lipid A export and possibly also in glycerophospholipid export and for biogenesis of the outer membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation.
Similar Products
Product Notes
The msbA1 msba1 (Catalog #AAA7020959) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-602aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the msbA1 msba1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSPKTNAL SSSDSANATT WQNFKRLVSY AKPYKLGFVA AIIGMLGYAA IDVYFLSQLK PLVDEGLSGA NANFMKWAPL FIIVAFTVRG IAHFIANYCL AWVGNNVVAD LRQKLFEHIM SMPVAFHDQT STGSLISKIT FDTEQVLNSV SKSILTIVQQ SAFIIGLLGL MFYYSWQLSL IFLLITPIIA VIVSVVSKRF RKVSKNIQGA MGEVTTAAEQ TFNGHKVVLT FGGQQREFSR FAKINKHNRQ QRMKMRATKS ASVPIIQVIA SFALAFVFYA ITSDSLRDSI SPGTFVSIIT YMTMLLRPLK MLTNVNSEFQ QGMAACTSIF SILDHEKEKD NGDKQLERAS GTLSFKHVDF SYKNTNTMTT SDKEQDTKLA LNDITFDLAP GETLALVGRS GSGKSTASSL LLRFYDATRG EILIDDTNIE QFQLKDLRKQ FSYVSQQVVL FNDTLANNIA YGKPEATEAE IIEAAKSAHV MEFAEHMEQG LETNIGENGA LLSGGQRQRV AIARALLCDT PFLILDEATS ALDTESERHI QDALQTLQQN RTSIVIAHRL STIENADKII VMEQGKIVEQ GNHQSLLAKQ GAYAQLHSFQ FE. It is sometimes possible for the material contained within the vial of "Lipid A export ATP-binding/permease protein MsbA 1 (msbA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
