Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2) Recombinant Protein | Ms4a2 recombinant protein

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2)

Gene Names
Ms4a2; FCIGA; Ms4a1; Fcer1b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2); Recombinant Rat High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2); Ms4a2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-243aa; Full length protein
Sequence
MDTENKSRADLALPNPQESPSAPDIELLEASPPAKALPEKPASPPPQQTWQSFLKKELEF LGVTQVLVGLICLCFGTVVCSTLQTSDFDDEVLLLYRAGYPFWGAVLFVLSGFLSIMSER KNTLYLVRGSLGANIVSSIAAGLGIAILILNLSNNSAYMNYCKDITEDDGCFVTSFITEL VLMLLFLTILAFCSAVLLIIYRIGQEFERSKVPDDRLYEELHVYSPIYSALEDTREASAP VVS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ms4a2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,731 Da
NCBI Official Full Name
high affinity immunoglobulin epsilon receptor subunit beta
NCBI Official Synonym Full Names
membrane spanning 4-domains A2
NCBI Official Symbol
Ms4a2
NCBI Official Synonym Symbols
FCIGA; Ms4a1; Fcer1b
NCBI Protein Information
high affinity immunoglobulin epsilon receptor subunit beta
UniProt Protein Name
High affinity immunoglobulin epsilon receptor subunit beta
UniProt Gene Name
Ms4a2
UniProt Synonym Gene Names
Fce1b; Fcer1b; FcERI
UniProt Entry Name
FCERB_RAT

NCBI Description

beta chain of the high affinity receptor for immunoglobulin E [RGD, Feb 2006]

Uniprot Description

FcER1B: High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy. Belongs to the MS4A family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, misc.

Cellular Component: endosome; external side of plasma membrane; Fc-epsilon receptor I complex; integral to plasma membrane; lipid raft

Molecular Function: IgE binding; IgE receptor activity; phosphoprotein binding; protein kinase binding; SH2 domain binding

Biological Process: cell surface receptor linked signal transduction; cytokine secretion; immune response; inflammatory response; phospholipase C activation; positive regulation of mast cell degranulation; protein kinase C activation; regulation of release of sequestered calcium ion into cytosol; signal transduction

Research Articles on Ms4a2

Similar Products

Product Notes

The Ms4a2 ms4a2 (Catalog #AAA7020833) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-243aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ms4a2 ms4a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDTENKSRAD LALPNPQESP SAPDIELLEA SPPAKALPEK PASPPPQQTW QSFLKKELEF LGVTQVLVGL ICLCFGTVVC STLQTSDFDD EVLLLYRAGY PFWGAVLFVL SGFLSIMSER KNTLYLVRGS LGANIVSSIA AGLGIAILIL NLSNNSAYMN YCKDITEDDG CFVTSFITEL VLMLLFLTIL AFCSAVLLII YRIGQEFERS KVPDDRLYEE LHVYSPIYSA LEDTREASAP VVS. It is sometimes possible for the material contained within the vial of "High affinity immunoglobulin epsilon receptor subunit beta (Ms4a2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.