28S ribosomal protein S22, mitochondrial (MRPS22) Recombinant Protein | MRPS22 recombinant protein

Recombinant Human 28S ribosomal protein S22, mitochondrial (MRPS22)

Cat. Num. AAA959100

• Gene Names: MRPS22; GIBT; GK002; C3orf5; COXPD5; RPMS22; MRP-S22
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 28S ribosomal protein S22; mitochondrial (MRPS22); Recombinant Human 28S ribosomal protein S22; mitochondrial; MRP-S22; S22mt; MRPS22 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-360aa; Full Length
• Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
• Sequence Length: 360

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Product Categories/Family for MRPS22 recombinant protein

Epigenetics and Nuclear Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 9910244
• NCBI GeneID: 56945
• NCBI Accession #: NP_064576.1
• NCBI GenBank Nucleotide #: NM_020191.2
• UniProt Accession #: P82650; Q9H3I1
• Molecular Weight: 68.3 kDa
• NCBI Official Full Name: 28S ribosomal protein S22, mitochondrial
• NCBI Official Synonym Full Names: mitochondrial ribosomal protein S22
• NCBI Official Symbol: MRPS22
• NCBI Official Synonym Symbols: GIBT; GK002; C3orf5; COXPD5; RPMS22; MRP-S22
• NCBI Protein Information: 28S ribosomal protein S22, mitochondrial; S22mt
• UniProt Protein Name: 28S ribosomal protein S22, mitochondrial
• Protein Family: 28S ribosomal protein
• UniProt Gene Name: MRPS22
• UniProt Synonym Gene Names: C3orf5; RPMS22; MRP-S22; S22mt
• UniProt Entry Name: RT22_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPS22: Defects in MRPS22 are the cause of combined oxidative phosphorylation deficiency type 5 (COXPD5). COXPD5 is an antenatal mitochondrial disease. Patients show edema, cardiomyopathy, tubulopathy, and hypotonia.

Protein type: Translation; Ribosomal; Mitochondrial

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial small ribosomal subunit; mitochondrial ribosome

Molecular Function: structural constituent of ribosome

Biological Process: mitochondrial translation; organelle organization and biogenesis

Disease: Combined Oxidative Phosphorylation Deficiency 5