Major royal jelly protein 3 (MRJP3) Recombinant Protein | MRJP3 recombinant protein
Recombinant Apis mellifera Major royal jelly protein 3 (MRJP3), partial
Gene Names
Mrjp3; GB16459
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major royal jelly protein 3 (MRJP3); Recombinant Apis mellifera Major royal jelly protein 3 (MRJP3); partial; MRJP3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-428aa; Partial-length
Sequence
AAVNHQRKSANNLAHSMKVIYEWKHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIERNNGVPSSLNVVTNKKGKGGPLLRPYPDWSFAKYEDCSGIVSAFKIAVDKFDRLWVLDSGLVNNNQPMCSPKLLTFDLKTSKLVKQVEIPHNIAVNATTGMGELVSLAVQAIDRTNTMVYIADEKGEGLIMYQNSDDSFHRLTSNTFDYDPRYTKLTVAGESFTVKNGIYGIALSPVTNNLYYSPLLSHGLYYVDTEQFSNPQYEENNVQYEGSQDILNTQSFGKVVSKNGVLFLGLVGNSGIACVNEHQVLQRESFDVVAQNEETLQMIVSMKIMENLPQSGRINDPEGNEYMLALSNRMQKIINNDFNFNDVNFRILGANVDDLMRNTRCGRYHNQNAG
Species
Apis mellifera (Honeybee)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,662 Da
NCBI Official Full Name
major royal jelly protein 3
NCBI Official Symbol
Mrjp3
NCBI Official Synonym Symbols
GB16459
NCBI Protein Information
major royal jelly protein 3
UniProt Protein Name
Major royal jelly protein 3
Protein Family
UniProt Gene Name
MRJP3
UniProt Synonym Gene Names
MRJP-3
Uniprot Description
May play an important role in honeybee nutrition. It is found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen.
Research Articles on MRJP3
Similar Products
Product Notes
The MRJP3 mrjp3 (Catalog #AAA1296531) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-428aa; Partial-length. The amino acid sequence is listed below: AAVNHQRKSA NNLAHSMKVI YEWKHIDFDF GSDERRDAAI KSGEFDHTKN YPFDVDRWRD KTFVTIERNN GVPSSLNVVT NKKGKGGPLL RPYPDWSFAK YEDCSGIVSA FKIAVDKFDR LWVLDSGLVN NNQPMCSPKL LTFDLKTSKL VKQVEIPHNI AVNATTGMGE LVSLAVQAID RTNTMVYIAD EKGEGLIMYQ NSDDSFHRLT SNTFDYDPRY TKLTVAGESF TVKNGIYGIA LSPVTNNLYY SPLLSHGLYY VDTEQFSNPQ YEENNVQYEG SQDILNTQSF GKVVSKNGVL FLGLVGNSGI ACVNEHQVLQ RESFDVVAQN EETLQMIVSM KIMENLPQSG RINDPEGNEY MLALSNRMQK IINNDFNFND VNFRILGANV DDLMRNTRCG RYHNQNAG. It is sometimes possible for the material contained within the vial of "Major royal jelly protein 3 (MRJP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
