SDS-PAGE
Penicillin-binding protein 1A (mrcA), partial Recombinant Protein | mrcA recombinant protein
Recombinant Escherichia coli Penicillin-binding protein 1A (mrcA), partial
Gene Names
mrcA; ECK3383; JW3359; ponA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Penicillin-binding protein 1A (mrcA); partial; Recombinant Escherichia coli Penicillin-binding protein 1A (mrcA); Penicillin-binding protein 1A; PBP-1a; PBP1a; Including the following 2 domains:; Penicillin-insensitive transglycosylase; EC=2.4.2.-; Peptidoglycan TGase; Penicillin-sensitive transpeptidase; EC=3.4.-.-; DD-transpeptidase; mrcA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
229-529aa; Partial
Sequence
MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for mrcA recombinant protein
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Product Categories/Family for mrcA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49.5 kDa
NCBI Official Full Name
penicillin-binding protein 1a, murein transglycosylase and transpeptidase
NCBI Official Symbol
mrcA
NCBI Official Synonym Symbols
ECK3383; JW3359; ponA
NCBI Protein Information
penicillin-binding protein 1a, murein transglycosylase and transpeptidase
UniProt Protein Name
Penicillin-binding protein 1A
UniProt Gene Name
mrcA
UniProt Synonym Gene Names
ponA; PBP-1a; PBP1a
UniProt Entry Name
PBPA_ECOLI
NCBI Description
The N-terminal transglycosylase activity polymerizes the glycan backbone and is penicillin-insensitive. [More information is available at EcoGene: EG10748]. PBP1A, the product of the mrcA gene, is a bifunctional, inner membrane enzyme catalyzing the transglycosylation and transpeptidation of murein (peptidoglycan) precursors in the formation of the murein sacculus. [More information is available at EcoCyc: EG10748].
Uniprot Description
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Research Articles on mrcA
Similar Products
Product Notes
The mrcA mrca (Catalog #AAA1078684) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 229-529aa; Partial. The amino acid sequence is listed below: MLDEGYITQQ QFDQTRTEAI NANYHAPEIA FSAPYLSEMV RQEMYNRYGE SAYEDGYRIY TTITRKVQQA AQQAVRNNVL DYDMRHGYRG PANVLWKVGE SAWDNNKITD TLKALPTYGP LLPAAVTSAN PQQATAMLAD GSTVALSMEG VRWARPYRSD TQQGPTPRKV TDVLQTGQQI WVRQVGDAWW LAQVPEVNSA LVSINPQNGA VMALVGGFDF NQSKFNRATQ ALRQVGSNIK PFLYTAAMDK GLTLASMLND VPISRWDASA GSDWQPKNSP PQYAGPIRLR QGLGQSKNVV M. It is sometimes possible for the material contained within the vial of "Penicillin-binding protein 1A (mrcA), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
