Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-mercaptopyruvate sulfurtransferase (Mpst) Recombinant Protein | Mpst recombinant protein

Recombinant Rat 3-mercaptopyruvate sulfurtransferase (Mpst)

Gene Names
Mpst; Mst
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-mercaptopyruvate sulfurtransferase (Mpst); Recombinant Rat 3-mercaptopyruvate sulfurtransferase (Mpst); Mpst recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-297, Full length protein
Sequence
AAPQLFRALVSAQWVAEALKSPRASQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPSATHFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRYWLSQNLPISSGKSPSEPAEFCAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTSEGLEKSPEEIQRLFQEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKPDVPVYDGSWVEWYMRAQPEHVISQGRGKTL
Sequence Length
296
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mpst recombinant protein
This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,940 Da
NCBI Official Full Name
3-mercaptopyruvate sulfurtransferase
NCBI Official Synonym Full Names
mercaptopyruvate sulfurtransferase
NCBI Official Symbol
Mpst
NCBI Official Synonym Symbols
Mst
NCBI Protein Information
3-mercaptopyruvate sulfurtransferase
UniProt Protein Name
3-mercaptopyruvate sulfurtransferase
UniProt Gene Name
Mpst
UniProt Synonym Gene Names
MST

NCBI Description

catalyzes the formation of thiocyanide and pyruvate [RGD, Feb 2006]

Uniprot Description

Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), contributes to the catabolism of cysteine and is an important producer of hydrogen sulfide in the brain, retina and vascular endothelial cells. Hydrogen sulfide H2S is an important synaptic modulator, signaling molecule, smooth muscle contractor and neuroprotectant. Its production by the 3MST/CAT pathway is regulated by calcium ions.

Research Articles on Mpst

Similar Products

Product Notes

The Mpst mpst (Catalog #AAA952963) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-297, Full length protein. The amino acid sequence is listed below: AAPQLFRALV SAQWVAEALK SPRASQPLKL LDASWYLPKL GRDARREFEE RHIPGAAFFD IDRCSDHTSP YDHMLPSATH FADYAGSLGV SAATHVVIYD GSDQGLYSAP RVWWMFRAFG HHSVSLLDGG FRYWLSQNLP ISSGKSPSEP AEFCAQLDPS FIKTHEDILE NLDARRFQVV DARAAGRFQG TQPEPRDGIE PGHIPGSVNI PFTEFLTSEG LEKSPEEIQR LFQEKKVDLS KPLVATCGSG VTACHVVLGA FLCGKPDVPV YDGSWVEWYM RAQPEHVISQ GRGKTL. It is sometimes possible for the material contained within the vial of "3-mercaptopyruvate sulfurtransferase (Mpst), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.