Utx blocking peptide
Utx Peptide - N-terminal region
Gene Names
Kdm6a; Utx
Reactivity
Mouse
Applications
Western Blot
Synonyms
Utx; Utx Peptide - N-terminal region; Utx blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
ATILQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGR
Sequence Length
1424
Applicable Applications for Utx blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Utx blocking peptide
The function of this protein remains unknown.
Product Categories/Family for Utx blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
157kDa
NCBI Official Full Name
lysine-specific demethylase 6A isoform 1
NCBI Official Synonym Full Names
lysine (K)-specific demethylase 6A
NCBI Official Symbol
Kdm6a
NCBI Official Synonym Symbols
Utx
NCBI Protein Information
lysine-specific demethylase 6A
UniProt Protein Name
Lysine-specific demethylase 6A
UniProt Gene Name
Kdm6a
UniProt Synonym Gene Names
Utx
Uniprot Description
Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A (). Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression (PubMed:21095589).
Research Articles on Utx
Similar Products
Product Notes
The Utx kdm6a (Catalog #AAA3226562) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Utx Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Utx can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Utx kdm6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATILQQLGWM HHTVDLLGDK ATKESYAIQY LQKSLEADPN SGQSWYFLGR. It is sometimes possible for the material contained within the vial of "Utx, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
