Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UST blocking peptide

UST Peptide - middle region

Gene Names
Ust; UA2OST; D930010O20Rik
Reactivity
Mouse
Synonyms
UST; UST Peptide - middle region; UST blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLL
Sequence Length
407
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for UST blocking peptide
This is a synthetic peptide designed for use in combination with anti- UST Antibody, made

Target Description: Sulfotransferase that catalyzes the transfer of sulfate to the position 2 of uronyl residues. Has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. Has no activity toward desulfated N-resulfated heparin (By similarity).
Product Categories/Family for UST blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
uronyl 2-sulfotransferase
NCBI Official Synonym Full Names
uronyl-2-sulfotransferase
NCBI Official Symbol
Ust
NCBI Official Synonym Symbols
UA2OST; D930010O20Rik
NCBI Protein Information
uronyl 2-sulfotransferase
UniProt Protein Name
Uronyl 2-sulfotransferase
Protein Family
UniProt Gene Name
Ust

Uniprot Description

UST: Sulfotransferase that catalyzes the transfer of sulfate to the position 2 of uronyl residues. Has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. Has no activity toward desulfated N-resulfated heparin. Belongs to the sulfotransferase 3 family.

Protein type: EC 2.8.2.-; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, integral; Transferase

Chromosomal Location of Human Ortholog: 10|10 A1

Cellular Component: Golgi apparatus; integral component of membrane; membrane

Molecular Function: sulfotransferase activity; transferase activity

Biological Process: establishment of cell polarity; regulation of axonogenesis

Research Articles on UST

Similar Products

Product Notes

The UST ust (Catalog #AAA3248218) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The UST Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRFLLDLRQY LGNSTYLDDH GPPPSKVLPF PSQVVYNRVG KCGSRTVVLL. It is sometimes possible for the material contained within the vial of "UST, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.