PTBP1 blocking peptide
PTBP1 Peptide-middle region
Gene Names
Ptbp1; Ptb; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; AA407203; AL033359
Reactivity
Mouse
Synonyms
PTBP1; PTBP1 Peptide-middle region; Ptb; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; AA407203; AL033359; PTBP1 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
LTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALA
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
527 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PTBP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PTBP1 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.
Description of Target: Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
56,478 Da
NCBI Official Full Name
Polypyrimidine tract-binding protein 1
NCBI Official Synonym Full Names
polypyrimidine tract binding protein 1
NCBI Official Symbol
Ptbp1
NCBI Official Synonym Symbols
Ptb; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; AA407203; AL033359
NCBI Protein Information
polypyrimidine tract-binding protein 1; hnRNP I; heterogeneous nuclear ribonucleoprotein I
UniProt Protein Name
Polypyrimidine tract-binding protein 1
Protein Family
UniProt Gene Name
Ptbp1
UniProt Synonym Gene Names
Ptb; PTB; hnRNP I
UniProt Entry Name
PTBP1_MOUSE
Similar Products
Product Notes
The PTBP1 ptbp1 (Catalog #AAA3249412) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PTBP1 Peptide-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: LTSLNVKYNN DKSRDYTRPD LPSGDSQPSL DQTMAAAFGL SVPNVHGALA. It is sometimes possible for the material contained within the vial of "PTBP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
