Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Pou5f1 blocking peptide

Pou5f1 Peptide - C-terminal region

Gene Names
Pou5f1; Oct3; Oct4; Otf3; Otf4; NF-A3; Oct-3; Oct-4; Otf-3; Otf-4; Otf3g; Oct3/4; Oct-3/4; Otf3-rs7
Reactivity
Mouse
Applications
Western Blot
Synonyms
Pou5f1; Pou5f1 Peptide - C-terminal region; Pou5f1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPG
Sequence Length
352
Applicable Applications for Pou5f1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Pou5f1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Pou5f1 Antibody, made

Target Description: The protein encoded by this gene belongs to the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein plays a key role in embryonic development and stem cell pluripotency. Alternative splicing results in multiple transcript variants.
Product Categories/Family for Pou5f1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
POU domain, class 5, transcription factor 1 isoform 1
NCBI Official Synonym Full Names
POU domain, class 5, transcription factor 1
NCBI Official Symbol
Pou5f1
NCBI Official Synonym Symbols
Oct3; Oct4; Otf3; Otf4; NF-A3; Oct-3; Oct-4; Otf-3; Otf-4; Otf3g; Oct3/4; Oct-3/4; Otf3-rs7
NCBI Protein Information
POU domain, class 5, transcription factor 1
UniProt Protein Name
POU domain, class 5, transcription factor 1
UniProt Gene Name
Pou5f1
UniProt Synonym Gene Names
Oct-3; Oct-4; Otf-3; Otf3; Oct-3; Oct-4; OTF-3
UniProt Entry Name
PO5F1_MOUSE

NCBI Description

The protein encoded by this gene belongs to the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein plays a key role in embryonic development and stem cell pluripotency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

Oct4: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. Interacts with UBE2I and ZSCAN10. Interacts with PKM2. Interacts with WWP2. Transcriptional activity is positively regulated by PKM2. Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues. Belongs to the POU transcription factor family. Class- 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Cellular Component: cytoplasm; cytosol; nuclear chromatin; nucleolus; nucleoplasm; nucleus; transcription factor complex; transcriptional repressor complex

Molecular Function: chromatin binding; chromatin DNA binding; cytokine binding; DNA binding; miRNA binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding; transcription corepressor activity; transcription factor activity; transcription factor binding; ubiquitin protein ligase binding

Biological Process: blastocyst growth; cell fate commitment; ectodermal cell fate commitment; endodermal cell fate commitment; endodermal cell fate specification; germ-line stem cell maintenance; mesodermal cell fate commitment; mRNA transcription from RNA polymerase II promoter; multicellular organismal development; negative regulation of calcium ion-dependent exocytosis; negative regulation of cell differentiation; negative regulation of protein kinase B signaling cascade; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of protein kinase B signaling cascade; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of gene expression; regulation of transcription, DNA-dependent; response to organic substance; response to retinoic acid; somatic stem cell maintenance; stem cell differentiation; stem cell maintenance; transcription from RNA polymerase II promoter; transcription, DNA-dependent; trophectodermal cell differentiation

Research Articles on Pou5f1

Similar Products

Product Notes

The Pou5f1 pou5f1 (Catalog #AAA3245166) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Pou5f1 Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Pou5f1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Pou5f1 pou5f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQITHIANQL GLEKDVVRVW FCNRRQKGKR SSIEYSQREE YEATGTPFPG. It is sometimes possible for the material contained within the vial of "Pou5f1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.