PDE7B blocking peptide
PDE7B Peptide - C-terminal region
Reactivity
Mouse
Synonyms
PDE7B; PDE7B Peptide - C-terminal region; PDE7B blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EPLFREWARFTGNSTLSENMLSHLAHNKAQWKSLLSNQHRRRGSGQDLAG
Sequence Length
446
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PDE7B blocking peptide
This is a synthetic peptide designed for use in combination with anti- PDE7B Antibody, made
Target Description: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
Target Description: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
Product Categories/Family for PDE7B blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
cAMP-specific 3',5'-cyclic phosphodiesterase 7B isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 7B
NCBI Official Symbol
Pde7b
NCBI Protein Information
cAMP-specific 3',5'-cyclic phosphodiesterase 7B
UniProt Protein Name
cAMP-specific 3',5'-cyclic phosphodiesterase 7B
Protein Family
UniProt Gene Name
Pde7b
Uniprot Description
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
Research Articles on PDE7B
Similar Products
Product Notes
The PDE7B pde7b (Catalog #AAA3248607) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PDE7B Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPLFREWARF TGNSTLSENM LSHLAHNKAQ WKSLLSNQHR RRGSGQDLAG. It is sometimes possible for the material contained within the vial of "PDE7B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
