OPN4 blocking peptide
OPN4 Peptide - N-terminal region
Gene Names
Opn4; Gm533; 1110007J02Rik
Reactivity
Mouse
Synonyms
OPN4; OPN4 Peptide - N-terminal region; OPN4 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRT
Sequence Length
466
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for OPN4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- OPN4 Antibody, made
Target Description: Photoreceptor required for regulation of circadian rhythm. Contributes to pupillar reflex and other non-image forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal.
Target Description: Photoreceptor required for regulation of circadian rhythm. Contributes to pupillar reflex and other non-image forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal.
Product Categories/Family for OPN4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
melanopsin isoform 2
NCBI Official Synonym Full Names
opsin 4 (melanopsin)
NCBI Official Symbol
Opn4
NCBI Official Synonym Symbols
Gm533; 1110007J02Rik
NCBI Protein Information
melanopsin
UniProt Protein Name
Melanopsin
Protein Family
UniProt Gene Name
Opn4
UniProt Synonym Gene Names
Mop; Mopn
UniProt Entry Name
OPN4_MOUSE
Research Articles on OPN4
Similar Products
Product Notes
The OPN4 opn4 (Catalog #AAA3248337) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The OPN4 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAWVPFPTV DVPDHAHYTL GTVILLVGLT GMLGNLTVIY TFCRNRGLRT. It is sometimes possible for the material contained within the vial of "OPN4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
