Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MSL3 blocking peptide

MSL3 Peptide-middle region

Reactivity
Mouse
Synonyms
MSL3; MSL3 Peptide-middle region; Msl31; Msl3l1; AU018931; MSL3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
VFAGFEGRRPNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVK
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
525 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MSL3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-MSL3 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: May be involved in chromatin remodeling and transcriptional regulation. May have a role in X inactivation. Component of the MSL complex which is responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure. Specifically recognizes histone H4 monomethylated at 'Lys-20' (H4K20Me1) in a DNA-dependent manner and is proposed to be involved in chromosomal targeting of the MSL complex (By similarity).

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
57kDa
UniProt Protein Name
Male-specific lethal 3 homolog
Protein Family
UniProt Gene Name
Msl3
UniProt Synonym Gene Names
Msl31; Msl3l1; MSL3-like 1
UniProt Entry Name
MS3L1_MOUSE

Similar Products

Product Notes

The MSL3 msl3 (Catalog #AAA3249524) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MSL3 Peptide-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: VFAGFEGRRP NEINEVLSWK LVPDNYPPGD QPPPPSYIYG AQHLLRLFVK. It is sometimes possible for the material contained within the vial of "MSL3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.