Mcm10 blocking peptide
Mcm10 Peptide - N-terminal region
Gene Names
Mcm10; C79164; AU018508; 2410041F14Rik; C330019M07Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
Mcm10; Mcm10 Peptide - N-terminal region; Mcm10 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV
Sequence Length
885
Applicable Applications for Mcm10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Mcm10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Mcm10 Antibody, made
Target Description: Mcm10 acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication.
Target Description: Mcm10 acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication.
Product Categories/Family for Mcm10 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
protein MCM10 homolog
NCBI Official Synonym Full Names
minichromosome maintenance 10 replication initiation factor
NCBI Official Symbol
Mcm10
NCBI Official Synonym Symbols
C79164; AU018508; 2410041F14Rik; C330019M07Rik
NCBI Protein Information
protein MCM10 homolog
UniProt Protein Name
Protein MCM10 homolog
Protein Family
UniProt Gene Name
Mcm10
UniProt Entry Name
MCM10_MOUSE
Research Articles on Mcm10
Similar Products
Product Notes
The Mcm10 mcm10 (Catalog #AAA3228225) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Mcm10 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Mcm10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Mcm10 mcm10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DEFDELFDAD GDGESYTEEA GSGEEGKTGN QEERLATLFG DVEDLTDDEV. It is sometimes possible for the material contained within the vial of "Mcm10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
