Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HSD3B5 blocking peptide

HSD3B5 Peptide - middle region

Reactivity
Mouse
Synonyms
HSD3B5; HSD3B5 Peptide - middle region; HSD3B5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLY
Sequence Length
373
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HSD3B5 blocking peptide
This is a synthetic peptide designed for use in combination with anti- HSD3B5 Antibody, made

Target Description: The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD V can only catalyze the conversion of dihydrotestosterone to 5 alpha-androstanediol in the presence of the cofactor NADPH. Does not function as a isomerase.
Product Categories/Family for HSD3B5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
NADPH-dependent 3-keto-steroid reductase Hsd3b5
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
NCBI Official Symbol
Hsd3b5
NCBI Protein Information
NADPH-dependent 3-keto-steroid reductase Hsd3b5
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase type 5
UniProt Gene Name
Hsd3b5
UniProt Synonym Gene Names
3-beta-HSD V
UniProt Entry Name
3BHS5_MOUSE

Uniprot Description

HSD3B5: The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD V can only catalyze the conversion of dihydrotestosterone to 5 alpha- androstanediol in the presence of the cofactor NADPH. Does not function as a isomerase. Belongs to the 3-beta-HSD family.

Protein type: Mitochondrial; Membrane protein, integral; EC 1.1.1.-; Oxidoreductase

Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: (R)-2-hydroxyglutarate dehydrogenase activity; (R)-2-hydroxyisocaproate dehydrogenase activity; 2-hydroxytetrahydrofuran dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-ketoglucose-reductase activity; 5-exo-hydroxycamphor dehydrogenase activity; acetoin dehydrogenase activity; aldo-keto reductase activity; arabinose reductase activity; C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity; D-arabinitol dehydrogenase (NADP+) activity; epoxide dehydrogenase activity; gluconate dehydrogenase activity; isocitrate dehydrogenase activity; mevaldate reductase activity; NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; phenylcoumaran benzylic ether reductase activity; steroid binding; steroid dehydrogenase activity; steroid dehydrogenase activity, acting on the CH-CH group of donors; steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; xylose reductase activity

Biological Process: steroid biosynthetic process

Similar Products

Product Notes

The HSD3B5 hsd3b5 (Catalog #AAA3248374) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HSD3B5 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKKSPSIQGQ FYYISDNTPH QSYDDLNYTL SKEWGLCLDS GWSLPLSLLY. It is sometimes possible for the material contained within the vial of "HSD3B5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.