Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gfap blocking peptide

Gfap Peptide - N-terminal region

Gene Names
Gfap; AI836096
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Synonyms
Gfap; Gfap Peptide - N-terminal region; Gfap blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL
Sequence Length
418
Applicable Applications for Gfap blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Protein Size
418 amino acids
Quality Control
The peptide has characterized by mass spectroscopy.
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Gfap blocking peptide
This is a synthetic peptide designed for use in combination with anti-Gfap Antibody, MBS3211770 made by MyBioSource. It may block above mentioned antibody from binding to its target in western blot and/or immunohistochemistry under proper exppirimental settings. There is no guarantee for its use in other applications. Please inquire for more info.
Product Categories/Family for Gfap blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
glial fibrillary acidic protein isoform 2
NCBI Official Synonym Full Names
glial fibrillary acidic protein
NCBI Official Symbol
Gfap
NCBI Official Synonym Symbols
AI836096
NCBI Protein Information
glial fibrillary acidic protein
UniProt Protein Name
Glial fibrillary acidic protein
UniProt Gene Name
Gfap
UniProt Synonym Gene Names
GFAP

Uniprot Description

GFAP: a class-III intermediate filament protein. A cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. An additional transcript variant isoform has been described, but its full length sequence has not been determined.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 11 E1|11 66.48 cM

Cellular Component: cell body; cell projection; cytoplasm; intermediate filament; intermediate filament cytoskeleton; intracellular; membrane; myelin sheath

Molecular Function: identical protein binding; integrin binding; kinase binding; protein binding; structural constituent of cytoskeleton; structural molecule activity

Biological Process: astrocyte development; Bergmann glial cell differentiation; extracellular matrix organization; intermediate filament organization; intermediate filament-based process; negative regulation of neuron projection development; neuron projection regeneration; positive regulation of Schwann cell proliferation; regulation of chaperone-mediated autophagy; regulation of neurotransmitter uptake; response to wounding

Research Articles on Gfap

Similar Products

Product Notes

The Gfap gfap (Catalog #AAA3236718) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Gfap Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Gfap can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the Gfap gfap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSLAGALNAG FKETRASERA EMMELNDRFA SYIEKVRFLE QQNKALAAEL. It is sometimes possible for the material contained within the vial of "Gfap, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.