Esrra blocking peptide
Esrra Peptide - C-terminal region
Gene Names
Esrra; Err1; Nr3b1; Estrra; ERRalpha
Reactivity
Mouse
Applications
Western Blot
Synonyms
Esrra; Esrra Peptide - C-terminal region; Esrra blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL
Sequence Length
422
Applicable Applications for Esrra blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Esrra blocking peptide
This is a synthetic peptide designed for use in combination with anti-Esrra Antibody, made
Target Description: Esrra binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. It can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. It binds to the C1 region of the lactoferrin gene promoter. It requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.
Target Description: Esrra binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. It can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. It binds to the C1 region of the lactoferrin gene promoter. It requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.
Product Categories/Family for Esrra blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
steroid hormone receptor ERR1
NCBI Official Synonym Full Names
estrogen related receptor, alpha
NCBI Official Symbol
Esrra
NCBI Official Synonym Symbols
Err1; Nr3b1; Estrra; ERRalpha
NCBI Protein Information
steroid hormone receptor ERR1
UniProt Protein Name
Steroid hormone receptor ERR1
Protein Family
UniProt Gene Name
Esrra
UniProt Synonym Gene Names
Err1; Estrra; Nr3b1; ERR-alpha
UniProt Entry Name
ERR1_MOUSE
Research Articles on Esrra
Similar Products
Product Notes
The Esrra esrra (Catalog #AAA3225867) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Esrra Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Esrra can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Esrra esrra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGRAGPGGGA ERRRAGRLLL TLPLLRQTAG KVLAHFYGVK LEGKVPMHKL. It is sometimes possible for the material contained within the vial of "Esrra, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
