Bnip3l blocking peptide
Bnip3l Peptide - middle region
Gene Names
Bnip3l; Nix; Nip3L; C86132; D14Ertd719e
Reactivity
Mouse
Applications
Western Blot
Synonyms
Bnip3l; Bnip3l Peptide - middle region; Bnip3l blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVS
Sequence Length
218
Applicable Applications for Bnip3l blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Bnip3l blocking peptide
This is a synthetic peptide designed for use in combination with anti-Bnip3l Antibody, made
Target Description: Bnip3l induces apoptosis. It interacts with viral and cellular anti-apoptosis proteins. It can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. It inhibits apoptosis induced by BNIP3. It is involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. Bnip3l may function as a tumor suppressor.
Target Description: Bnip3l induces apoptosis. It interacts with viral and cellular anti-apoptosis proteins. It can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. It inhibits apoptosis induced by BNIP3. It is involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. Bnip3l may function as a tumor suppressor.
Product Categories/Family for Bnip3l blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
NCBI Official Synonym Full Names
BCL2/adenovirus E1B interacting protein 3-like
NCBI Official Symbol
Bnip3l
NCBI Official Synonym Symbols
Nix; Nip3L; C86132; D14Ertd719e
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
Protein Family
UniProt Gene Name
Bnip3l
UniProt Synonym Gene Names
Nix; NIP3L
UniProt Entry Name
BNI3L_MOUSE
Research Articles on Bnip3l
Similar Products
Product Notes
The Bnip3l bnip3l (Catalog #AAA3239030) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Bnip3l Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Bnip3l can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Bnip3l bnip3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CDSPSPQEDG QIMFDVEMHT SRDHSSQSEE EVVEGEKEVE ALKKSADWVS. It is sometimes possible for the material contained within the vial of "Bnip3l, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
