Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Amhr2 blocking peptide

Amhr2 Peptide - N-terminal region

Gene Names
Amhr2; C14; Mrii; Misiir; Misrii
Reactivity
Mouse
Applications
Western Blot
Synonyms
Amhr2; Amhr2 Peptide - N-terminal region; Amhr2 blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
PAAAQVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCC
Sequence Length
568
Applicable Applications for Amhr2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Amhr2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Amhr2 Antibody, made

Target Description: On ligand binding, Amhr2 forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. It is a receptor for anti-Muellerian hormone.
Product Categories/Family for Amhr2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
anti-Muellerian hormone type-2 receptor
NCBI Official Synonym Full Names
anti-Mullerian hormone type 2 receptor
NCBI Official Symbol
Amhr2
NCBI Official Synonym Symbols
C14; Mrii; Misiir; Misrii
NCBI Protein Information
anti-Muellerian hormone type-2 receptor
UniProt Protein Name
Anti-Muellerian hormone type-2 receptor
UniProt Gene Name
Amhr2
UniProt Synonym Gene Names
AMH type II receptor; MISRII; MRII
UniProt Entry Name
AMHR2_MOUSE

Research Articles on Amhr2

Similar Products

Product Notes

The Amhr2 amhr2 (Catalog #AAA3234462) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Amhr2 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Amhr2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Amhr2 amhr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAAAQVSPNR RTCVFFEAPG VRGSTKTLGE MVDAGPGPPK GIRCLYSHCC. It is sometimes possible for the material contained within the vial of "Amhr2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual