Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ZSCAN16 Monoclonal Antibody | anti-ZSCAN16 antibody

ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3) (AP)

Gene Names
ZSCAN16; ZNF392; ZNF435; dJ265C24.3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZSCAN16; Monoclonal Antibody; ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16; Zinc Finger Protein 392; ZNF392; Zinc Finger Protein 435; ZNF435; dJ265C24.3) (AP); anti-ZSCAN16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4A9
Specificity
Recognizes human ZNF435.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ZSCAN16 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa132-230 from human ZNF435 (NP_079507) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of ZSCAN16 expression in transfected 293T cell line by ZNF435 monoclonal antibody. Lane 1: ZSCAN16 transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZSCAN16 expression in transfected 293T cell line by ZNF435 monoclonal antibody. Lane 1: ZSCAN16 transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZSCAN16 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZSCAN16 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZSCAN16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,792 Da
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 16
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 16
NCBI Official Symbol
ZSCAN16
NCBI Official Synonym Symbols
ZNF392; ZNF435; dJ265C24.3
NCBI Protein Information
zinc finger and SCAN domain-containing protein 16; zinc finger protein 392; zinc finger protein 435
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 16
UniProt Gene Name
ZSCAN16
UniProt Synonym Gene Names
ZNF392; ZNF435
UniProt Entry Name
ZSC16_HUMAN

Uniprot Description

ZSCAN16: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on ZSCAN16

Similar Products

Product Notes

The ZSCAN16 zscan16 (Catalog #AAA6134681) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZSCAN16 zscan16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZSCAN16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.