<
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in NIH/3T3.)
Mouse ZNF622 Monoclonal Antibody | anti-ZNF622 antibody
ZNF622 (Zinc Finger Protein 622, MGC17552, MGC2485, ZPR9) (PE)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ZNF622; Monoclonal Antibody; ZNF622 (Zinc Finger Protein 622; MGC17552; MGC2485; ZPR9) (PE); Zinc Finger Protein 622; ZPR9; anti-ZNF622 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G6
Specificity
Recognizes ZNF622.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
477
Applicable Applications for anti-ZNF622 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZNF622 (NP_219482, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in NIH/3T3.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in NIH/3T3.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in PC-12.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in PC-12.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Hela S3 NE.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Hela S3 NE.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Raw 264.7.)
Western Blot (WB)
(ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Raw 264.7.)
Related Product Information for anti-ZNF622 antibody
Mouse monoclonal antibody raised against a partial recombinant ZNF622.
Product Categories/Family for anti-ZNF622 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
zinc finger protein 622
UniProt Protein Name
Zinc finger protein 622
Protein Family
UniProt Gene Name
ZNF622
UniProt Synonym Gene Names
ZPR9
UniProt Entry Name
ZN622_HUMAN
Uniprot Description
ZNF622: May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
Protein type: Transcription factor
Chromosomal Location of Human Ortholog: 5p15.1
Cellular Component: Golgi apparatus; cytoplasm; nucleolus
Molecular Function: protein binding; zinc ion binding
Biological Process: positive regulation of MAPKKK cascade; positive regulation of apoptosis; positive regulation of kinase activity; positive regulation of JNK cascade; induction of apoptosis by oxidative stress
Similar Products
Product Notes
The ZNF622 znf622 (Catalog #AAA6187090) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZNF622 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF622 znf622 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF622, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
