Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M02), clone 4D6.Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa).Lane 2: Non-transfected lysate.)

Mouse ZNF41 Monoclonal Antibody | anti-ZNF41 antibody

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (AP)

Gene Names
ZNF41; MRX89
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ZNF41; Monoclonal Antibody; ZNF41 (Zinc Finger Protein 41; MGC8941; MRX89) (AP); Zinc Finger Protein 41; MRX89; anti-ZNF41 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D6
Specificity
Recognizes ZNF41.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
779
Applicable Applications for anti-ZNF41 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZNF41 (NP_009061, 221aa-321aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M02), clone 4D6.Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M02), clone 4D6.Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-ZNF41 antibody
This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known. [provided by RefSeq]
Product Categories/Family for anti-ZNF41 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
zinc finger protein 41 isoform a
NCBI Official Synonym Full Names
zinc finger protein 41
NCBI Official Symbol
ZNF41
NCBI Official Synonym Symbols
MRX89
NCBI Protein Information
zinc finger protein 41
UniProt Protein Name
Zinc finger protein 41
Protein Family
UniProt Gene Name
ZNF41
UniProt Entry Name
ZNF41_HUMAN

NCBI Description

This gene encodes a protein that contains KRAB-A and KRAB-B domains multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. An initial study suggested that this gene may be associated with X-linked cognitive disability, but a later study has called this finding into question (PMID:23871722).[provided by RefSeq, Apr 2016]

Research Articles on ZNF41

Similar Products

Product Notes

The ZNF41 znf41 (Catalog #AAA6161784) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZNF41 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF41 znf41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF41, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.