Mouse anti-Human ZNF397 Monoclonal Antibody | anti-ZNF397 antibody

ZNF397 (Zinc Finger Protein 397, Zinc Finger and SCAN Domain-containing Protein 15, ZSCAN15, Zinc Finger Protein 47, ZNF47) (PE)

Cat. Num. AAA6161193

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ZNF397; Monoclonal Antibody; ZNF397 (Zinc Finger Protein 397; Zinc Finger and SCAN Domain-containing Protein 15; ZSCAN15; Zinc Finger Protein 47; ZNF47) (PE); anti-ZNF397 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F8
• Specificity: Recognizes human ZNF397.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 275

• Applicable Applications for anti-ZNF397 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa131-231 from human ZNF397 (NP_115723) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EFDDPGQQVPASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEPSFRGIKLSRPPKASSAIRWE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of ZNF397 expression in transfected 293T cell line by ZNF397 monoclonal antibody. Lane 1: ZNF397 transfected lysate (31.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZNF397 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ZNF397 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-ZNF397 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 14150143
• NCBI Accession #: NP_115723.1
• NCBI GenBank Nucleotide #: NM_032347
• UniProt Accession #: Q8NF99
• NCBI Official Full Name: zinc finger protein 397 isoform 2
• UniProt Protein Name: Zinc finger protein 397
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF397
• UniProt Synonym Gene Names: ZNF47; ZSCAN15
• UniProt Entry Name: ZN397_HUMAN

Uniprot Description

ZNF397: Isoform 3 acts as a DNA-dependent transcriptional repressor. Belongs to the krueppel C2H2-type zinc-finger protein family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 18q12.2

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent