Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.14kD).)

Mouse anti-Human ZNF365 Monoclonal Antibody | anti-ZNF365 antibody

ZNF365 (Zinc Finger Protein 365, KIAA0844, Protein ZNF365, Protein su48) (AP)

Gene Names
ZNF365; UAN; Su48; ZNF365D
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF365; Monoclonal Antibody; ZNF365 (Zinc Finger Protein 365; KIAA0844; Protein ZNF365; Protein su48) (AP); anti-ZNF365 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E3
Specificity
Recognizes human ZNF365.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3988
Applicable Applications for anti-ZNF365 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa147-220 from ZNF365 (NP_055766) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.14kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.14kD).)

Western Blot (WB)

(Western Blot analysis of ZNF365 expression in transfected 293T cell line by ZNF365 monoclonal antibody Lane 1: ZNF365 transfected lysate (Predicted MW: 31.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF365 expression in transfected 293T cell line by ZNF365 monoclonal antibody Lane 1: ZNF365 transfected lysate (Predicted MW: 31.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZNF365 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF365 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF365 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens zinc finger protein 365 (ZNF365), transcript variant A, mRNA
NCBI Official Synonym Full Names
zinc finger protein 365
NCBI Official Symbol
ZNF365
NCBI Official Synonym Symbols
UAN; Su48; ZNF365D
NCBI Protein Information
protein ZNF365
UniProt Protein Name
Protein ZNF365
Protein Family
UniProt Gene Name
ZNF365

NCBI Description

This gene encodes a zinc finger protein that may play a role in the repair of DNA damage and maintenance of genome stability. The N-terminal C2H2 zinc finger motif is required to form a protein complex with PARP1 and MRE11, which are known to be involved in the restart of stalled DNA replication forks. A mutation in this gene may be associated with breast cancer susceptibility. [provided by RefSeq, Mar 2020]

Uniprot Description

Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (PubMed:17389905). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligodendrocyte differentiation during postnatal growth. Involved in dendritic arborization, morphogenesis of spine density dendrite, and establishment of postsynaptic dendrite density in cortical pyramidal neurons (). Involved in homologous recombination (HR) repair pathway. Required for proper resolution of DNA double-strand breaks (DSBs) by HR. Is required for recovery of stalled replication forks, and directly contributes to genomic stability. Interacts with PARP1 and mediates MRE11-dependent DNA end resection during replication fork recovery (PubMed:23966166). Contributes to genomic stability by preventing telomere dysfunction (PubMed:23776040).

Research Articles on ZNF365

Similar Products

Product Notes

The ZNF365 znf365 (Catalog #AAA6134673) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF365 (Zinc Finger Protein 365, KIAA0844, Protein ZNF365, Protein su48) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF365 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF365 znf365 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF365, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.