Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.77kD).)

Mouse anti-Human ZNF306 Monoclonal Antibody | anti-ZKSCAN3 antibody

ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS

Gene Names
ZKSCAN3; ZF47; Zfp47; ZFP306; ZNF306; ZNF309; zfp-47; ZSCAN13; ZSCAN35; dJ874C20.1; dJ874C20.1.
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF306; Monoclonal Antibody; ZNF306 (Zinc Finger Protein 306; ZFP306; Zinc Finger Protein with KRAB and SCAN Domains 3; ZKSCAN3; Zinc Finger and SCAN Domain-containing Protein 13; ZSCAN13; Zinc Finger Protein 309; ZNF309; Zinc Finger Protein 47 Homolog; ZFP47; Zf47; Zfp47; Zfp-47; ZS; Anti -ZNF306 (Zinc Finger Protein 306; anti-ZKSCAN3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A1
Specificity
Recognizes human ZNF306.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
CGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNIL
Applicable Applications for anti-ZKSCAN3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa431-537 from human ZNF306 (NP_077819) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.77kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.77kD).)
Product Categories/Family for anti-ZKSCAN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,641 Da
NCBI Official Full Name
zinc finger protein with KRAB and SCAN domains 3 isoform 2
NCBI Official Synonym Full Names
zinc finger with KRAB and SCAN domains 3
NCBI Official Symbol
ZKSCAN3
NCBI Official Synonym Symbols
ZF47; Zfp47; ZFP306; ZNF306; ZNF309; zfp-47; ZSCAN13; ZSCAN35; dJ874C20.1; dJ874C20.1.
NCBI Protein Information
zinc finger protein with KRAB and SCAN domains 3; zinc finger protein 306; zinc finger protein 309; zinc finger protein zfp47; zinc finger protein 47 homolog; zinc finger and SCAN domain-containing protein 13
UniProt Protein Name
Zinc finger protein with KRAB and SCAN domains 3
UniProt Gene Name
ZKSCAN3
UniProt Synonym Gene Names
ZFP47; ZNF306; ZNF309; ZSCAN13; Zf47; Zfp-47
UniProt Entry Name
ZKSC3_HUMAN

Uniprot Description

ZNF306: Acts as a transcriptional regulator. Binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3'. Associates with chromatin at the ITGB4 and VEGF promoters. Activates the transcription of genes associated with colon cancer progression. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; metal ion binding; chromatin binding; transcription factor activity

Biological Process: negative regulation of autophagy; transcription, DNA-dependent; lysosome organization and biogenesis; positive regulation of transcription, DNA-dependent; autophagy; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on ZKSCAN3

Similar Products

Product Notes

The ZKSCAN3 zkscan3 (Catalog #AAA643982) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF306 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZKSCAN3 zkscan3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CGKAFRRSSH LLRHQRIHTG DKNVQEPEQG EAWKSRMESQ LENVETPMSY KCNECERSFT QNTGLIEHQK IHTGEKPYQC NACGKGFTRI SYLVQHQRSH VGKNIL. It is sometimes possible for the material contained within the vial of "ZNF306, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.