Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ZNF274 over-expressed 293 cell line, cotransfected with ZNF274 Validated Chimera RNAi (Cat # H0MBS60936462-R01V) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF274 monoclonal antibody (M04), clone 1D8. GAPDH (36.1 kDa) used as specificity and loading control.)

Mouse ZNF274 Monoclonal Antibody | anti-ZNF274 antibody

ZNF274 (Zinc Finger Protein 274, DKFZp686K08243, FLJ37843, HFB101, ZF2, ZKSCAN19) (HRP)

Gene Names
ZNF274; ZF2; HFB101; ZSCAN51; ZKSCAN19
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ZNF274; Monoclonal Antibody; ZNF274 (Zinc Finger Protein 274; DKFZp686K08243; FLJ37843; HFB101; ZF2; ZKSCAN19) (HRP); Zinc Finger Protein 274; ZKSCAN19; anti-ZNF274 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D8
Specificity
Recognizes ZNF274.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
653
Applicable Applications for anti-ZNF274 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZNF274 (NP_598009, 420aa-530aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western blot analysis of ZNF274 over-expressed 293 cell line, cotransfected with ZNF274 Validated Chimera RNAi (Cat # H0MBS60936462-R01V) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF274 monoclonal antibody (M04), clone 1D8. GAPDH (36.1 kDa) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ZNF274 over-expressed 293 cell line, cotransfected with ZNF274 Validated Chimera RNAi (Cat # H0MBS60936462-R01V) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF274 monoclonal antibody (M04), clone 1D8. GAPDH (36.1 kDa) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of ZNF274 expression in transfected 293T cell line by ZNF274 monoclonal antibody (M04), clone 1D8.Lane 1: ZNF274 transfected lysate (74.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF274 expression in transfected 293T cell line by ZNF274 monoclonal antibody (M04), clone 1D8.Lane 1: ZNF274 transfected lysate (74.2 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF274 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF274 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF274 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF274 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-ZNF274 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neurotrophin receptor-interacting factor homolog isoform c
NCBI Official Synonym Full Names
zinc finger protein 274
NCBI Official Symbol
ZNF274
NCBI Official Synonym Symbols
ZF2; HFB101; ZSCAN51; ZKSCAN19
NCBI Protein Information
neurotrophin receptor-interacting factor homolog
UniProt Protein Name
Neurotrophin receptor-interacting factor homolog
UniProt Gene Name
ZNF274
UniProt Synonym Gene Names
ZKSCAN19; SP2114; Zf2
UniProt Entry Name
ZN274_HUMAN

NCBI Description

This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq, Jul 2008]

Research Articles on ZNF274

Similar Products

Product Notes

The ZNF274 znf274 (Catalog #AAA6179512) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZNF274 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF274 znf274 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF274, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.