Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody. Lane 1: ZNF18 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ZNF18 Monoclonal Antibody | anti-ZNF18 antibody

ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC

Gene Names
ZNF18; HDSG1; KOX11; ZNF535; Zfp535; ZKSCAN6; ZSCAN38
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZNF18; Monoclonal Antibody; ZNF18 (Zinc Finger Protein 18; Heart Development-specific Gene 1 Protein; HDSG1; Zinc Finger Protein 535; ZNF535; Zinc Finger Protein KOX11; KOX11; Zinc Finger Protein with KRAB and SCAN Domains 6; ZKSCAN6) APC; anti-ZNF18 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A4
Specificity
Recognizes human ZNF18.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ZNF18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa282-381 from human ZNF18 (NP_653281) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody. Lane 1: ZNF18 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF18 expression in transfected 293T cell line by ZNF18 monoclonal antibody. Lane 1: ZNF18 transfected lysate (62.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZNF18 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF18 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
zinc finger protein 18 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 18
NCBI Official Symbol
ZNF18
NCBI Official Synonym Symbols
HDSG1; KOX11; ZNF535; Zfp535; ZKSCAN6; ZSCAN38
NCBI Protein Information
zinc finger protein 18
UniProt Protein Name
Zinc finger protein 18
Protein Family
UniProt Gene Name
ZNF18
UniProt Synonym Gene Names
HDSG1; KOX11; ZKSCAN6; ZNF535
UniProt Entry Name
ZNF18_HUMAN

Uniprot Description

ZNF18: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The ZNF18 znf18 (Catalog #AAA6139945) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF18 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF18 znf18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF18, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.