Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Mouse anti-Human ZNF157 Monoclonal Antibody | anti-ZNF157 antibody

ZNF157 (Zinc Finger Protein 157, Zinc Finger Protein HZF22)

Gene Names
ZNF157; HZF22
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF157; Monoclonal Antibody; ZNF157 (Zinc Finger Protein 157; Zinc Finger Protein HZF22); Anti -ZNF157 (Zinc Finger Protein 157; anti-ZNF157 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G3
Specificity
Recognizes human ZNF157.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
IEHQRMHSGEKPYECSECGKIFSMKKSLCQHRRTHTGEKPYECSECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQRTHIGWSWRCTMKKAS*
Applicable Applications for anti-ZNF157 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa402-505 from human ZNF157 (NP_003437) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.55kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.55kD).)

Testing Data

(Detection limit for recombinant GST tagged ZNF157 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF157 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF157 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
58,291 Da
NCBI Official Full Name
ZNF157
NCBI Official Synonym Full Names
zinc finger protein 157
NCBI Official Symbol
ZNF157
NCBI Official Synonym Symbols
HZF22
NCBI Protein Information
zinc finger protein 157; zinc finger protein 22; zinc finger protein HZF22
UniProt Protein Name
Zinc finger protein 157
Protein Family
UniProt Gene Name
ZNF157
UniProt Entry Name
ZN157_HUMAN

NCBI Description

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. [provided by RefSeq, Jul 2008]

Uniprot Description

ZNF157: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The ZNF157 znf157 (Catalog #AAA6005099) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF157 (Zinc Finger Protein 157, Zinc Finger Protein HZF22) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF157 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZNF157 znf157 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IEHQRMHSGE KPYECSECGK IFSMKKSLCQ HRRTHTGEKP YECSECGNAF YVKVRLIEHQ RIHTGERPFE CQECGKAFCR KAHLTEHQRT HIGWSWRCTM KKAS*. It is sometimes possible for the material contained within the vial of "ZNF157, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.