Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD))

Mouse anti-Human ZNF155 Monoclonal Antibody | anti-ZNF155 antibody

ZNF155 (Zinc Finger Protein 155, PHZ-96)

Gene Names
ZNF155; pHZ-96
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF155; Monoclonal Antibody; ZNF155 (Zinc Finger Protein 155; PHZ-96); Anti -ZNF155 (Zinc Finger Protein 155; anti-ZNF155 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F11
Specificity
Recognizes human ZNF155.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRR*
Applicable Applications for anti-ZNF155 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa422-520 from human ZNF155 (NP_003436) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD))

Western Blot (WB) (Western Blot detection against Immunogen (37kD))

Testing Data

(Detection limit for recombinant GST tagged ZNF155 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF155 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF155 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,081 Da
NCBI Official Full Name
zinc finger protein 155 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 155
NCBI Official Symbol
ZNF155
NCBI Official Synonym Symbols
pHZ-96
NCBI Protein Information
zinc finger protein 155; KRAB A domain
UniProt Protein Name
Zinc finger protein 155
Protein Family
UniProt Gene Name
ZNF155
UniProt Entry Name
ZN155_HUMAN

Uniprot Description

ZNF155: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.2-q13.32

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The ZNF155 znf155 (Catalog #AAA6009697) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF155 (Zinc Finger Protein 155, PHZ-96) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF155 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZNF155 znf155 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSGEKPYKCE ECGKGYVTKF NLDLHQRVHT GERPYNCKEC GKNFSRASSI LNHKRLHCQK KPFKCEDCGK RLVHRTYRKD QPRDYSGENP SKCEDCGRR*. It is sometimes possible for the material contained within the vial of "ZNF155, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.