Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZIC3 is approximately 10ng/ml as a capture antibody.)

Mouse ZIC3 Monoclonal Antibody | anti-ZIC3 antibody

ZIC3 (Zic Family Member 3 (odd-Paired Homolog, Drosophila), HTX, HTX1, ZNF203) (Biotin)

Gene Names
ZIC3; HTX; HTX1; ZNF203; VACTERLX
Applications
Western Blot
Purity
Purified
Synonyms
ZIC3; Monoclonal Antibody; ZIC3 (Zic Family Member 3 (odd-Paired Homolog; Drosophila); HTX; HTX1; ZNF203) (Biotin); Zic Family Member 3 (odd-Paired Homolog; ZNF203; anti-ZIC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F7
Specificity
Recognizes ZIC3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ZIC3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZIC3 (NP_003404.1, 182aa-274aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZIC3 is approximately 10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZIC3 is approximately 10ng/ml as a capture antibody.)
Related Product Information for anti-ZIC3 antibody
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq]
Product Categories/Family for anti-ZIC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,045 Da
NCBI Official Full Name
zinc finger protein ZIC 3
NCBI Official Synonym Full Names
Zic family member 3
NCBI Official Symbol
ZIC3
NCBI Official Synonym Symbols
HTX; HTX1; ZNF203; VACTERLX
NCBI Protein Information
zinc finger protein ZIC 3; heterotaxy 1; zinc finger protein 203; zinc finger protein of the cerebellum 3; Zic family member 3 (odd-paired homolog, Drosophila)
UniProt Protein Name
Zinc finger protein ZIC 3
Protein Family
UniProt Gene Name
ZIC3
UniProt Synonym Gene Names
ZNF203
UniProt Entry Name
ZIC3_HUMAN

NCBI Description

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. [provided by RefSeq, Jul 2008]

Uniprot Description

ZIC3: Acts as transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'. Defects in ZIC3 are the cause of visceral heterotaxy X- linked type 1 (HTX1). A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects. Clinical features of visceral heterotaxy X- linked type 1 include dextrocardia, corrected transposition of great arteries, ventricular septal defect, patent ductus arteriosus, pulmonic stenosis, situs inversus viscerum, and asplenia and/or polysplenia. Defects in ZIC3 are a cause of VACTERL association X- linked with or without hydrocephalus (VACTERLX). A syndrome characterized by vertebral anomalies, anal atresia, cardiac malformations, tracheoesophageal fistula, renal anomalies (urethral atresia with hydronephrosis), and limb anomalies (hexadactyly, humeral hypoplasia, radial aplasia, and proximally placed thumb). Some patients may have hydrocephalus. Some cases of VACTERL-H are associated with increased chromosome breakage and rearrangement. Belongs to the GLI C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: Xq26.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; transcription, DNA-dependent; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; heart looping; determination of left/right symmetry; lung development

Disease: Vacterl Association, X-linked, With Or Without Hydrocephalus; Heterotaxy, Visceral, 1, X-linked

Research Articles on ZIC3

Similar Products

Product Notes

The ZIC3 zic3 (Catalog #AAA6172364) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZIC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZIC3 zic3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZIC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.