Mouse anti-Human ZHX1 Monoclonal Antibody | anti-ZHX1 antibody

ZHX1 (Zinc Fingers and Homeoboxes Protein 1)

Cat. Num. AAA6013233

• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZHX1; Monoclonal Antibody; ZHX1 (Zinc Fingers and Homeoboxes Protein 1); Anti -ZHX1 (Zinc Fingers and Homeoboxes Protein 1); anti-ZHX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5E5
• Specificity: Recognizes human ZHX1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILKDYYLKRKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGI*

• Applicable Applications for anti-ZHX1 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa731-830 from ZHX1 (NP_009153) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZHX1 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-ZHX1 antibody

Antibodies; Abs to Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 63079683
• NCBI GeneID: 11244
• NCBI Accession #: NP_001017926.1
• NCBI GenBank Nucleotide #: NM_001017926.2
• UniProt Accession #: Q9UKY1; Q8IWD8
• Molecular Weight: 98,098 Da
• NCBI Official Full Name: zinc fingers and homeoboxes protein 1
• NCBI Official Synonym Full Names: zinc fingers and homeoboxes 1
• NCBI Official Symbol: ZHX1
• NCBI Protein Information: zinc fingers and homeoboxes protein 1; zinc fingers and homeobox 1; zinc finger and homeodomain protein 1
• UniProt Protein Name: Zinc fingers and homeoboxes protein 1
• Protein Family: Zinc fingers and homeoboxes protein
• UniProt Gene Name: ZHX1
• UniProt Entry Name: ZHX1_HUMAN

NCBI Description

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 1 of this gene family. In addition to forming homodimers, this protein heterodimerizes with members 2 and 3 of the zinc fingers and homeoboxes family. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 8 open reading frame 76 (C8orf76) gene. [provided by RefSeq, Feb 2011]

Uniprot Description

ZHX1: Acts as a transcriptional repressor. Increases DNMT3B- mediated repressive transcriptional activity when DNMT3B is tethered to DNA. May link molecule between DNMT3B and other co- repressor proteins. Belongs to the ZHX family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 8q24.13

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; metal ion binding; transcription factor activity; transcription corepressor activity

Biological Process: transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; cell differentiation; negative regulation of transcription, DNA-dependent