Testing Data
(Detection limit for recombinant GST tagged ZDHHC8 is 0.1 ng/ml as a capture antibody.)
Mouse ZDHHC8 Monoclonal Antibody | anti-ZDHHC8 antibody
ZDHHC8 (Zinc Finger, DHHC-Type Containing 8, ZDHHCL1, ZNF378) (APC)
Gene Names
ZDHHC8; DHHC8; ZNF378; ZDHHCL1
Applications
Western Blot
Purity
Purified
Synonyms
ZDHHC8; Monoclonal Antibody; ZDHHC8 (Zinc Finger; DHHC-Type Containing 8; ZDHHCL1; ZNF378) (APC); Zinc Finger; ZNF378; anti-ZDHHC8 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G8
Specificity
Recognizes ZDHHC8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
42
Applicable Applications for anti-ZDHHC8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZDHHC8 (AAH09442, 1aa-42aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ZDHHC8 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ZDHHC8 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-ZDHHC8 antibody
Mouse monoclonal antibody raised against a full-length recombinant ZDHHC8.
Product Categories/Family for anti-ZDHHC8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
ZDHHC8 protein
NCBI Official Synonym Full Names
zinc finger DHHC-type palmitoyltransferase 8
NCBI Official Symbol
ZDHHC8
NCBI Official Synonym Symbols
DHHC8; ZNF378; ZDHHCL1
NCBI Protein Information
probable palmitoyltransferase ZDHHC8
Protein Family
NCBI Description
This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22.[provided by RefSeq, May 2010]
Research Articles on ZDHHC8
Similar Products
Product Notes
The ZDHHC8 (Catalog #AAA6168195) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZDHHC8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZDHHC8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZDHHC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
