Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 monoclonal antibody (M02), clone 4G11.Lane 1: ZCCHC13 transfected lysate (Predicted MW: 18 KDa).Lane 2: Non-transfected lysate.)

Mouse ZCCHC13 Monoclonal Antibody | anti-ZCCHC13 antibody

ZCCHC13 (Zinc Finger, CCHC Domain Containing 13, Cnbp2, ZNF9L) (FITC)

Gene Names
ZCCHC13; CNBP2; ZNF9L
Applications
Western Blot
Purity
Purified
Synonyms
ZCCHC13; Monoclonal Antibody; ZCCHC13 (Zinc Finger; CCHC Domain Containing 13; Cnbp2; ZNF9L) (FITC); Zinc Finger; ZNF9L; anti-ZCCHC13 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G11
Specificity
Recognizes ZCCHC13.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ZCCHC13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZCCHC13 (NP_976048.1, 1aa-166aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 monoclonal antibody (M02), clone 4G11.Lane 1: ZCCHC13 transfected lysate (Predicted MW: 18 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 monoclonal antibody (M02), clone 4G11.Lane 1: ZCCHC13 transfected lysate (Predicted MW: 18 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZCCHC13 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZCCHC13 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-ZCCHC13 antibody
Mouse monoclonal antibody raised against a full-length recombinant ZCCHC13.
Product Categories/Family for anti-ZCCHC13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,005 Da
NCBI Official Full Name
zinc finger CCHC domain-containing protein 13
NCBI Official Synonym Full Names
zinc finger CCHC-type containing 13
NCBI Official Symbol
ZCCHC13
NCBI Official Synonym Symbols
CNBP2; ZNF9L
NCBI Protein Information
zinc finger CCHC domain-containing protein 13
UniProt Protein Name
Zinc finger CCHC domain-containing protein 13
UniProt Gene Name
ZCCHC13

NCBI Description

This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. [provided by RefSeq, May 2010]

Similar Products

Product Notes

The ZCCHC13 zcchc13 (Catalog #AAA6178320) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZCCHC13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZCCHC13 zcchc13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZCCHC13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.