Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZBTB16 is ~1ng/ml as a capture antibody.)

Mouse anti-Human ZBTB16 Monoclonal Antibody | anti-ZBTB16 antibody

ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, Promyelocytic Leukemia Zinc Finger Protein, PLZF, Zinc Finger Protein 145, ZNF145, Zinc Finger Protein PLZF) (HRP)

Gene Names
ZBTB16; PLZF; ZNF145
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZBTB16; Monoclonal Antibody; ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16; Promyelocytic Leukemia Zinc Finger Protein; PLZF; Zinc Finger Protein 145; ZNF145; Zinc Finger Protein PLZF) (HRP); anti-ZBTB16 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A7
Specificity
Recognizes human ZBTB16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2374
Applicable Applications for anti-ZBTB16 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa381-481 from human ZBTB16 (AAH29812) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZBTB16 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZBTB16 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ZBTB16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens zinc finger and BTB domain containing 16, mRNA
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 16
NCBI Official Symbol
ZBTB16
NCBI Official Synonym Symbols
PLZF; ZNF145
NCBI Protein Information
zinc finger and BTB domain-containing protein 16

NCBI Description

This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Research Articles on ZBTB16

Similar Products

Product Notes

The ZBTB16 (Catalog #AAA6155815) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, Promyelocytic Leukemia Zinc Finger Protein, PLZF, Zinc Finger Protein 145, ZNF145, Zinc Finger Protein PLZF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB16 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZBTB16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZBTB16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.