Mouse YY1 Monoclonal Antibody | anti-YY1 antibody

YY1 (YY1 Transcription Factor, DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1) (Biotin)

Cat. Num. AAA6170600

• Gene Names: YY1; DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: YY1; Monoclonal Antibody; YY1 (YY1 Transcription Factor; DELTA; INO80S; NF-E1; UCRBP; YIN-YANG-1) (Biotin); YY1 Transcription Factor; YIN-YANG-1; anti-YY1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C5
• Specificity: Recognizes YY1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-YY1 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: YY1 (NP_003394, 221aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 7 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 7 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(YY1 monoclonal antibody (M04), clone 2C5 Western Blot analysis of YY1 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.)

Related Product Information for anti-YY1 antibody

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. [provided by RefSeq]

Product Categories/Family for anti-YY1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4507955
• NCBI GeneID: 7528
• NCBI Accession #: NP_003394
• NCBI GenBank Nucleotide #: NM_003403.4
• UniProt Accession #: P25490; Q14935
• Molecular Weight: 47.1kDa (437aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
• NCBI Official Full Name: transcriptional repressor protein YY1
• NCBI Official Synonym Full Names: YY1 transcription factor
• NCBI Official Symbol: YY1
• NCBI Official Synonym Symbols: DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1
• NCBI Protein Information: transcriptional repressor protein YY1
• UniProt Protein Name: Transcriptional repressor protein YY1
• Protein Family: YY1-associated factor
• UniProt Gene Name: YY1
• UniProt Synonym Gene Names: INO80S; YY-1
• UniProt Entry Name: TYY1_HUMAN

NCBI Description

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. [provided by RefSeq, Jul 2008]