Testing Data
(Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml as a capture antibody.)
Mouse YAP1 Monoclonal Antibody | anti-YAP1 antibody
YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (Biotin)
Gene Names
YAP1; YAP; YKI; COB1; YAP2; YAP65
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
YAP1; Monoclonal Antibody; YAP1 (Yes-Associated Protein 1; 65kD; YAP; YAP2; YAP65; YKI) (Biotin); Yes-Associated Protein 1; YKI; anti-YAP1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C2
Specificity
Recognizes YAP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
450
Applicable Applications for anti-YAP1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
YAP1 (NP_006097, 53aa-161aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-YAP1 antibody
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq]
Product Categories/Family for anti-YAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
transcriptional coactivator YAP1 isoform 2
NCBI Official Synonym Full Names
Yes1 associated transcriptional regulator
NCBI Official Symbol
YAP1
NCBI Official Synonym Symbols
YAP; YKI; COB1; YAP2; YAP65
NCBI Protein Information
transcriptional coactivator YAP1
Protein Family
NCBI Description
This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]
Research Articles on YAP1
Similar Products
Product Notes
The YAP1 (Catalog #AAA6171087) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's YAP1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YAP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
