Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human WWP1 Monoclonal Antibody | anti-WWP1 antibody

WWP1 (WW Domain-containing Protein 1, Atrophin-1-interacting Protein 5, AIP5, NEDD4-like E3 Ubiquitin-protein Ligase WWP1, TGIF-interacting Ubiquitin Ligase 1, Tiul1, hSDRP1) (MaxLight 490)

Gene Names
WWP1; AIP5; Tiul1; hSDRP1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WWP1; Monoclonal Antibody; WWP1 (WW Domain-containing Protein 1; Atrophin-1-interacting Protein 5; AIP5; NEDD4-like E3 Ubiquitin-protein Ligase WWP1; TGIF-interacting Ubiquitin Ligase 1; Tiul1; hSDRP1) (MaxLight 490); WW Domain Containing E3 Ubiquitin Protein Ligase 1; EC=6.3.2.-; anti-WWP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A7
Specificity
Recognizes human WWP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-WWP1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa152-261 from human WWP1 (NP_008944) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-WWP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105kDa
NCBI Official Full Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
NCBI Official Synonym Full Names
WW domain containing E3 ubiquitin protein ligase 1
NCBI Official Symbol
WWP1
NCBI Official Synonym Symbols
AIP5; Tiul1; hSDRP1
NCBI Protein Information
NEDD4-like E3 ubiquitin-protein ligase WWP1
UniProt Protein Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
UniProt Gene Name
WWP1
UniProt Synonym Gene Names
AIP5; Tiul1

NCBI Description

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq, Jul 2008]

Uniprot Description

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Ubiquitinates ERBB4 isoforms JM-A CYT-1 and JM-B CYT-1, KLF2, KLF5 and TP63 and promotes their proteasomal degradation. Ubiquitinates RNF11 without targeting it for degradation. Ubiquitinates and promotes degradation of TGFBR1; the ubiquitination is enhanced by SMAD7. Ubiquitinates SMAD6 and SMAD7. Ubiquitinates and promotes degradation of SMAD2 in response to TGF-beta signaling, which requires interaction with TGIF.

Research Articles on WWP1

Similar Products

Product Notes

The WWP1 wwp1 (Catalog #AAA6204117) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WWP1 (WW Domain-containing Protein 1, Atrophin-1-interacting Protein 5, AIP5, NEDD4-like E3 Ubiquitin-protein Ligase WWP1, TGIF-interacting Ubiquitin Ligase 1, Tiul1, hSDRP1) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WWP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WWP1 wwp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WWP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.