Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200124_WB11.jpg WB (Western Blot) (WB Suggested Anti-APOH antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit APOH Polyclonal Antibody | anti-APOH antibody

APOH antibody - N-terminal region

Gene Names
APOH; BG; B2G1; B2GP1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
APOH, Antibody; APOH antibody - N-terminal region; anti-APOH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
Sequence Length
345
Applicable Applications for anti-APOH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-APOH antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA200124_WB11.jpg WB (Western Blot) (WB Suggested Anti-APOH antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-APOH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateAPOH is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200124_WB13.jpg WB (Western Blot) (WB Suggested Anti-APOH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateAPOH is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(Rabbit Anti-APOH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA200124_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-APOH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-APOH antibody
This is a rabbit polyclonal antibody against APOH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
350
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
beta-2-glycoprotein 1
NCBI Official Synonym Full Names
apolipoprotein H
NCBI Official Symbol
APOH
NCBI Official Synonym Symbols
BG; B2G1; B2GP1
NCBI Protein Information
beta-2-glycoprotein 1
UniProt Protein Name
Beta-2-glycoprotein 1
UniProt Gene Name
APOH
UniProt Synonym Gene Names
B2G1; Apo-H; B2GPI; Beta(2)GPI
UniProt Entry Name
APOH_HUMAN

Similar Products

Product Notes

The APOH apoh (Catalog #AAA200124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOH antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the APOH apoh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LWPINTLKCT PRVCPFAGIL ENGAVRYTTF EYPNTISFSC NTGFYLNGAD. It is sometimes possible for the material contained within the vial of "APOH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.