Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (51.08kD).)

Mouse anti-Human WISP2 Monoclonal Antibody | anti-WISP2 antibody

WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) APC

Gene Names
WISP2; CCN5; CT58; CTGF-L
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WISP2; Monoclonal Antibody; WISP2 (WNT1-inducible-signaling Pathway Protein 2; WISP-2; CCN Family Member 5; CCN5; Connective Tissue Growth Factor-like Protein; CTGF-L; CTGFL; Connective Tissue Growth Factor-related Protein 58; CT58; UNQ228/PRO261) APC; anti-WISP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes human WISP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-WISP2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa24-251 from WISP2 (AAH17782) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDCSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (51.08kD).)

Western Blot (WB)

(Western Blot analysis of WISP2 expression in transfected 293T cell line by WISP2 monoclonal antibody Lane 1: WISP2 transfected lysate (26.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WISP2 expression in transfected 293T cell line by WISP2 monoclonal antibody Lane 1: WISP2 transfected lysate (26.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of WISP2 transfected lysate using WISP2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with WISP2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of WISP2 transfected lysate using WISP2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with WISP2 rabbit polyclonal antibody.)
Product Categories/Family for anti-WISP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
22,577 Da
NCBI Official Full Name
Homo sapiens WNT1 inducible signaling pathway protein 2, mRNA
NCBI Official Synonym Full Names
WNT1 inducible signaling pathway protein 2
NCBI Official Symbol
WISP2
NCBI Official Synonym Symbols
CCN5; CT58; CTGF-L
NCBI Protein Information
WNT1-inducible-signaling pathway protein 2

NCBI Description

This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq, Jul 2008]

Research Articles on WISP2

Similar Products

Product Notes

The WISP2 (Catalog #AAA6139875) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WISP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WISP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WISP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.