Mouse anti-Human WDR5 Monoclonal Antibody | anti-WDR5 antibody

WDR5 (WD Repeat-containing Protein 5, BMP2-induced 3-kb Gene Protein, BIG3, SWD3) (HRP)

Cat. Num. AAA6155777

• Gene Names: WDR5; SWD3; BIG-3; CFAP89
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WDR5; Monoclonal Antibody; WDR5 (WD Repeat-containing Protein 5; BMP2-induced 3-kb Gene Protein; BIG3; SWD3) (HRP); anti-WDR5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C2
• Specificity: Recognizes human WDR5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-WDR5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa16-121 from human WDR5 (NP_060058) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB)

(WDR5 monoclonal antibody. Western Blot analysis of WDR5 expression in A-549.)

Western Blot (WB)

(WDR5 monoclonal antibody. Western Blot analysis of WDR5 expression in Hs 181.Tes.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to WDR5 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged WDR5 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-WDR5 antibody

Antibodies; WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16554627
• NCBI GeneID: 11091
• NCBI Accession #: NP_060058
• NCBI GenBank Nucleotide #: NM_017588
• UniProt Accession #: P61964; Q91VA5; Q9NWX7; Q9UGP9
• Molecular Weight: 36,588 Da
• NCBI Official Full Name: WD repeat-containing protein 5
• NCBI Official Synonym Full Names: WD repeat domain 5
• NCBI Official Symbol: WDR5
• NCBI Official Synonym Symbols: SWD3; BIG-3; CFAP89
• NCBI Protein Information: WD repeat-containing protein 5; WD-repeat protein 5; BMP2-induced 3-kb gene protein; SWD3, Set1c WD40 repeat protein, homolog; cilia and flagella associated protein 89
• UniProt Protein Name: WD repeat-containing protein 5
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: WDR5
• UniProt Synonym Gene Names: BIG3
• UniProt Entry Name: WDR5_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

WDR5: a WD40 repeat protein. May accelerate osteoblast differentiation. Interacts with HCFC1. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: nucleoplasm; histone methyltransferase complex; nucleus; histone acetyltransferase complex

Molecular Function: protein binding; histone lysine N-methyltransferase activity (H3-K4 specific); histone acetyltransferase activity (H4-K16 specific)

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; histone H3-K4 methylation; skeletal development