Mouse anti-Human WDR13 Monoclonal Antibody | anti-WDR13 antibody

WDR13 (WD Repeat-containing Protein 13, MG21)

Cat. Num. AAA6001151

• Gene Names: WDR13; MG21
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: WDR13; Monoclonal Antibody; WDR13 (WD Repeat-containing Protein 13; MG21); Anti -WDR13 (WD Repeat-containing Protein 13; anti-WDR13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G9
• Specificity: Recognizes human WDR13.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: GTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVERAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRREQ

• Applicable Applications for anti-WDR13 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: ELISA: 0.1ng/ml
• Immunogen: Partial recombinant corresponding to aa391-485 from human WDR13 (NP_060353) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Testing Data

(Detection limit for recombinant GST tagged WDR13 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-WDR13 antibody

Antibodies; Abs to WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 261878584
• NCBI GeneID: 64743
• NCBI Accession #: NP_001159898.1
• NCBI GenBank Nucleotide #: NM_001166426.1
• UniProt Accession #: Q9H1Z4; Q06DX1; Q9BUL7; Q9NWW4
• Molecular Weight: 53,696 Da
• NCBI Official Full Name: WD repeat-containing protein 13 isoform 2
• NCBI Official Synonym Full Names: WD repeat domain 13
• NCBI Official Symbol: WDR13
• NCBI Official Synonym Symbols: MG21
• NCBI Protein Information: WD repeat-containing protein 13
• UniProt Protein Name: WD repeat-containing protein 13
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: WDR13
• UniProt Entry Name: WDR13_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is widely expressed in various tissues. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

WDR13: a nuclear WD40 repeat protein. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleoplasm; cytoplasm