Mouse anti-Human WBSCR22 Monoclonal Antibody | anti-WBSCR22 antibody
WBSCR22 (Williams-Beuren Syndrome Chromosomal Region 22 Protein, Uncharacterized Methyltransferase WBSCR22, HUSSY-03, PP3381, HASJ4442, MERM1, WBMT) (MaxLight 490)
Gene Names
WBSCR22; WBMT; MERM1; PP3381; HUSSY-3; HASJ4442
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WBSCR22; Monoclonal Antibody; WBSCR22 (Williams-Beuren Syndrome Chromosomal Region 22 Protein; Uncharacterized Methyltransferase WBSCR22; HUSSY-03; PP3381; HASJ4442; MERM1; WBMT) (MaxLight 490); EC=2.1.1.-; anti-WBSCR22 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E12
Specificity
Recognizes human WBSCR22.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-WBSCR22 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human WBSCR22 (NP_059998) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-WBSCR22 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-WBSCR22 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,846 Da
NCBI Official Full Name
probable 18S rRNA (guanine-N(7))-methyltransferase isoform 2
NCBI Official Synonym Full Names
Williams-Beuren syndrome chromosome region 22
NCBI Official Symbol
WBSCR22
NCBI Official Synonym Symbols
WBMT; MERM1; PP3381; HUSSY-3; HASJ4442
NCBI Protein Information
probable 18S rRNA (guanine-N(7))-methyltransferase
UniProt Protein Name
Probable 18S rRNA (guanine-N(7))-methyltransferase
Protein Family
UniProt Gene Name
WBSCR22
UniProt Synonym Gene Names
MERM1
UniProt Entry Name
WBS22_HUMAN
NCBI Description
This gene encodes a protein containing a nuclear localization signal and an S-adenosyl-L-methionine binding motif typical of methyltransferases, suggesting that the encoded protein may act on DNA methylation. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2011]
Research Articles on WBSCR22
Similar Products
Product Notes
The WBSCR22 wbscr22 (Catalog #AAA6204097) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WBSCR22 (Williams-Beuren Syndrome Chromosomal Region 22 Protein, Uncharacterized Methyltransferase WBSCR22, HUSSY-03, PP3381, HASJ4442, MERM1, WBMT) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WBSCR22 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WBSCR22 wbscr22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WBSCR22, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
