Mouse anti-Human WBP1 Monoclonal Antibody | anti-WBP1 antibody

WBP1 (WW Domain-binding Protein 1, WBP-1) (Biotin)

Cat. Num. AAA6145162

• Gene Names: WBP1; WBP-1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WBP1; Monoclonal Antibody; WBP1 (WW Domain-binding Protein 1; WBP-1) (Biotin); anti-WBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5F6
• Specificity: Recognizes human WBP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1175

• Applicable Applications for anti-WBP1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa170-268 from WBP1 (NP_036609) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGD*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Immunofluorescence of monoclonal antibody to WBP1 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-WBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519314138
• NCBI GeneID: 23559
• NCBI Accession #: NM_012477.4
• NCBI GenBank Nucleotide #: NM_012477
• UniProt Accession #: Q96G27
• NCBI Official Full Name: Homo sapiens WW domain binding protein 1 (WBP1), mRNA
• NCBI Official Synonym Full Names: WW domain binding protein 1
• NCBI Official Symbol: WBP1
• NCBI Official Synonym Symbols: WBP-1
• NCBI Protein Information: WW domain-binding protein 1
• UniProt Protein Name: WW domain-binding protein 1
• Protein Family: WW domain-binding protein
• UniProt Gene Name: WBP1
• UniProt Synonym Gene Names: WBP-1
• UniProt Entry Name: WBP1_HUMAN

NCBI Description

The globular WW domain, named for the conserved tryptophan residues in the protein motif present in various structural and regulatory proteins, is known to play a role in the mediation of protein-protein interactions. This gene encodes a ligand of the WW domain of the Yes kinase-associated protein. Readthrough transcription of the neighboring upstream gene, which encodes INO80 complex subunit B, into this gene generates a non-coding transcript. [provided by RefSeq, Feb 2011]