Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa (Cat # L013V1).)

Mouse WASF2 Monoclonal Antibody | anti-WASF2 antibody

WASF2 (WAS Protein Family, Member 2, SCAR2, WAVE2, dJ393P12.2) (Biotin)

Gene Names
WASF2; IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2
Applications
Western Blot
Purity
Purified
Synonyms
WASF2; Monoclonal Antibody; WASF2 (WAS Protein Family; Member 2; SCAR2; WAVE2; dJ393P12.2) (Biotin); WAS Protein Family; dJ393P12.2; anti-WASF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F7
Specificity
Recognizes WASF2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
498
Applicable Applications for anti-WASF2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
WASF2 (NP_008921, 73aa-172aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged WASF2 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WASF2 is approximately 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-WASF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
wiskott-Aldrich syndrome protein family member 2 isoform 1
NCBI Official Synonym Full Names
WASP family member 2
NCBI Official Symbol
WASF2
NCBI Official Synonym Symbols
IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2
NCBI Protein Information
wiskott-Aldrich syndrome protein family member 2
UniProt Protein Name
Wiskott-Aldrich syndrome protein family member 2
UniProt Gene Name
WASF2
UniProt Synonym Gene Names
WAVE2; WASP family protein member 2
UniProt Entry Name
WASF2_HUMAN

NCBI Description

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

WAVE2: Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Binds actin and the Arp2/3 complex. Interacts with BAIAP2. Component of the WAVE2 complex composed of ABI1, CYFIP1/SRA1, NCKAP1/NAP1 and WASF2/WAVE2. Directly interacts with BRK1. Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle. Belongs to the SCAR/WAVE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: ruffle; lamellipodium; early endosome; intracellular; intercellular junction; cytosol; actin cytoskeleton

Molecular Function: protein binding; protein complex binding; actin binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; lamellipodium biogenesis; negative regulation of stress fiber formation; actin filament-based movement; ameboidal cell migration; Rac protein signal transduction; innate immune response; angiogenesis; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis

Research Articles on WASF2

Similar Products

Product Notes

The WASF2 wasf2 (Catalog #AAA6172709) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's WASF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WASF2 wasf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WASF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.