Mouse WASF2 Monoclonal Antibody | anti-WASF2 antibody

WASF2 (WAS Protein Family, Member 2, SCAR2, WAVE2, dJ393P12.2) (Biotin)

Cat. Num. AAA6172709

• Gene Names: WASF2; IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2
• Applications: Western Blot
• Purity: Purified
• Synonyms: WASF2; Monoclonal Antibody; WASF2 (WAS Protein Family; Member 2; SCAR2; WAVE2; dJ393P12.2) (Biotin); WAS Protein Family; dJ393P12.2; anti-WASF2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F7
• Specificity: Recognizes WASF2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 498

• Applicable Applications for anti-WASF2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: WASF2 (NP_008921, 73aa-172aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(WASF2 monoclonal antibody (M01), clone 1F7. Western Blot analysis of WASF2 expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged WASF2 is approximately 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-WASF2 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 11386183
• NCBI GeneID: 10163
• NCBI Accession #: NP_008921
• NCBI GenBank Nucleotide #: NP_008921.1
• UniProt Accession #: Q9Y6W5
• NCBI Official Full Name: wiskott-Aldrich syndrome protein family member 2 isoform 1
• NCBI Official Synonym Full Names: WASP family member 2
• NCBI Official Symbol: WASF2
• NCBI Official Synonym Symbols: IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2
• NCBI Protein Information: wiskott-Aldrich syndrome protein family member 2
• UniProt Protein Name: Wiskott-Aldrich syndrome protein family member 2
• Protein Family: Wiskott-Aldrich syndrome protein family
• UniProt Gene Name: WASF2
• UniProt Synonym Gene Names: WAVE2; WASP family protein member 2
• UniProt Entry Name: WASF2_HUMAN

NCBI Description

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

WAVE2: Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Binds actin and the Arp2/3 complex. Interacts with BAIAP2. Component of the WAVE2 complex composed of ABI1, CYFIP1/SRA1, NCKAP1/NAP1 and WASF2/WAVE2. Directly interacts with BRK1. Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle. Belongs to the SCAR/WAVE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: ruffle; lamellipodium; early endosome; intracellular; intercellular junction; cytosol; actin cytoskeleton

Molecular Function: protein binding; protein complex binding; actin binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; lamellipodium biogenesis; negative regulation of stress fiber formation; actin filament-based movement; ameboidal cell migration; Rac protein signal transduction; innate immune response; angiogenesis; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis