Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WARS monoclonal antibody, Western Blot analysis of WARS expression in HeLa.)

Mouse anti-Human WARS Monoclonal Antibody | anti-WARS antibody

WARS (Tryptophan--tRNA Ligase, Cytoplasmic, Interferon-induced Protein 53, IFI53, IFP53, Tryptophanyl-tRNA Synthetase, TrpRS, hWRS, WRS) (AP)

Gene Names
WARS; IFI53; IFP53; GAMMA-2
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WARS; Monoclonal Antibody; WARS (Tryptophan--tRNA Ligase; Cytoplasmic; Interferon-induced Protein 53; IFI53; IFP53; Tryptophanyl-tRNA Synthetase; TrpRS; hWRS; WRS) (AP); EC=6.1.1.2; anti-WARS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A12
Specificity
Recognizes human WARS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-WARS antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa50-149 from WARS (NP_004175) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(WARS monoclonal antibody, Western Blot analysis of WARS expression in HeLa.)

Western Blot (WB) (WARS monoclonal antibody, Western Blot analysis of WARS expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of WARS expression in transfected 293T cell line by WARS monoclonal antibody. Lane 1: WARS transfected lysate (53.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WARS expression in transfected 293T cell line by WARS monoclonal antibody. Lane 1: WARS transfected lysate (53.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to WARS on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to WARS on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of WARS transfected lysate using WARS monoclonal antibody and Protein A Magnetic Bead and immunoblotted with WARS rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of WARS transfected lysate using WARS monoclonal antibody and Protein A Magnetic Bead and immunoblotted with WARS rabbit polyclonal antibody.)
Product Categories/Family for anti-WARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,852 Da
NCBI Official Full Name
tryptophan--tRNA ligase, cytoplasmic isoform a
NCBI Official Synonym Full Names
tryptophanyl-tRNA synthetase
NCBI Official Symbol
WARS
NCBI Official Synonym Symbols
IFI53; IFP53; GAMMA-2
NCBI Protein Information
tryptophan--tRNA ligase, cytoplasmic; hWRS; interferon-induced protein 53; trpRS; tryptophan tRNA ligase 1, cytoplasmic
UniProt Protein Name
Tryptophan--tRNA ligase, cytoplasmic
Protein Family
UniProt Gene Name
WARS
UniProt Synonym Gene Names
IFI53; WRS; IFP53; TrpRS; hWRS
UniProt Entry Name
SYWC_HUMAN

Similar Products

Product Notes

The WARS wars (Catalog #AAA6134551) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WARS (Tryptophan--tRNA Ligase, Cytoplasmic, Interferon-induced Protein 53, IFI53, IFP53, Tryptophanyl-tRNA Synthetase, TrpRS, hWRS, WRS) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WARS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WARS wars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WARS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.