Mouse anti-Human VPS26A Monoclonal Antibody | anti-VPS26A antibody

VPS26A (Vacuolar Protein Sorting-associated Protein 26A, Vesicle Protein Sorting 26A, VPS26, hVPS26, HB58, PEP8A, Hbeta58) (FITC)

Cat. Num. AAA6150451

• Gene Names: VPS26A; HB58; PEP8A; VPS26; Hbeta58
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VPS26A; Monoclonal Antibody; VPS26A (Vacuolar Protein Sorting-associated Protein 26A; Vesicle Protein Sorting 26A; VPS26; hVPS26; HB58; PEP8A; Hbeta58) (FITC); anti-VPS26A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C4
• Specificity: Recognizes human VPS26A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-VPS26A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa228-327 from VPS26A (NP_004887) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of VPS26A expression in transfected 293T cell line by VPS26A monoclonal antibody 1C4Lane 1: VPS26A transfected lysate (38.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged VPS26A is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-VPS26A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 17978519
• NCBI GeneID: 9559
• NCBI Accession #: NP_004887.2
• NCBI GenBank Nucleotide #: NM_004896.4
• Molecular Weight: 28,938 Da
• NCBI Official Full Name: vacuolar protein sorting-associated protein 26A isoform 1
• NCBI Official Synonym Full Names: VPS26 retromer complex component A
• NCBI Official Symbol: VPS26A
• NCBI Official Synonym Symbols: HB58; PEP8A; VPS26; Hbeta58
• NCBI Protein Information: vacuolar protein sorting-associated protein 26A
• Protein Family: Vacuolar protein sorting-associated protein

NCBI Description

This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]